(data stored in ACNUC7421 zone)

EMBL: CP000821.PE398

CP000821.PE398       Location/Qualifiers
FT   CDS_pept        466420..466917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35011"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ88"
FT                   /protein_id="ABV35011.1"
FT                   /translation="MRSYLLAASLTFLSFTSQAAPTPTEVVESFIQAYNKHDVELMVQH
FT                   TSETVRWMHITGTKVEVETSDRTEFGAAMTDYFETLKDANATILQIIDSGSYVSTVERV
FT                   TWDNDGEHLSQCSIGTFRVKAGKLAEFWYFPAHACDEQPPQEMIEQDVVEPEIGVLQET
FT                   QQ"
     atgaggtctt atctactcgc cgccagttta actttcctat cctttacctc acaagcagct        60
     cccacaccta ctgaagtggt cgaaagtttc atccaggctt acaacaagca tgacgttgaa       120
     ttaatggtgc agcatacgag tgagactgta cgttggatgc atatcactgg aaccaaagtg       180
     gaggtggaaa catcagaccg aaccgagttt ggtgcggcga tgactgacta ttttgagaca       240
     cttaaagatg ccaatgccac cattctccag atcattgatt caggtagtta tgttagtacg       300
     gttgaaagag tgacctggga taacgacggt gagcacctta gccagtgcag tatcggtaca       360
     tttagggtta aagccggaaa gttagccgaa ttttggtatt tccctgccca tgcttgtgat       420
     gaacagcctc cacaggagat gattgaacaa gatgttgtag agcccgagat cggtgtttta       480
     caagagactc aacaataa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page