(data stored in ACNUC7421 zone)

EMBL: CP000821.PE399

CP000821.PE399       Location/Qualifiers
FT   CDS_pept        466976..468463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0399"
FT                   /product="glycerol kinase"
FT                   /note="KEGG: slo:Shew_3466 glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35012"
FT                   /db_xref="GOA:A8FQ89"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ89"
FT                   /protein_id="ABV35012.1"
FT                   /translation="MAKKYVVALDQGTTSSRAIIFDHDANIVSVSQREFPQIYPQAGWV
FT                   EHDPMEIWASQSSTLIELLARSGIHGSEVAAIGITNQRETTVIWDKLTGKPVYNAIVWQ
FT                   CRRSSHICDELKAQGLEDYVRETTGLLLDPYFSGTKIKWILDNVAGVRERAEKGELLFG
FT                   TIDTWLVWKLTEGKVHVTDPTNASRTLLFNIHTQQWDSKLLEALNIPESLLPEVKPSCA
FT                   VYGKTRIAGEGGEISIAGIAGDQQSALFGQLCIDEGMAKNTYGTGCFLLMNTGKQAVKS
FT                   THGLLTTVAIGADCEVNYALEGAVFMGGATIQWLRDELGLIRDAQDTEYFASKVEDTNG
FT                   VYLVPAFVGLGAPYWDPNARGALVGLTRGSNRNHIIRAALEAIAYQSRDLLDAMAKDSG
FT                   VMLKQLKVDGGAVSNDFLMQFQADITNVEVQRPAITETTAMGAAFLAGLAVGFWSSTSE
FT                   LKHKADIERTFIPSISAEKCDELYCGWNRAVTQTIKS"
     gtggctaaaa agtatgtggt ggcattagat cagggtacaa caagttcaag agcgatcata        60
     ttcgatcatg atgccaatat tgtttctgta tcacagcgag agtttcctca gatttaccct       120
     caggccggtt gggtcgaaca tgatcccatg gagatatggg cctcacagag ctctaccctt       180
     atcgaactgc ttgctcggtc cgggatccat ggtagtgagg tcgctgcgat tgggatcacc       240
     aatcaacgtg aaacgaccgt catctgggat aagttaaccg gtaaaccagt ttataacgct       300
     attgtctggc agtgtcgtcg cagtagtcat atctgtgatg agctaaaagc gcaggggctg       360
     gaagattatg tgcgtgagac aacaggctta ctgctcgacc cctatttttc aggcactaag       420
     attaagtgga tcttggataa cgttgcgggc gtcagagaga gagcagaaaa aggagagtta       480
     ctgtttggca ctatcgatac ctggttggtt tggaagctga ccgagggaaa agtgcatgtt       540
     accgacccca ccaatgccag tcgtactctg ttatttaata tccatactca gcaatgggat       600
     agtaagttac tggaggcact gaatattcca gagtccctgc ttcctgaagt taagccttcc       660
     tgtgcggtgt acggtaagac ccgcattgca ggtgaaggcg gcgaaataag tattgctggc       720
     attgcaggcg atcagcagtc agccttgttc ggacagcttt gtatcgatga ggggatggcg       780
     aaaaatactt acggtacagg ctgtttcttg ttgatgaaca cgggtaaaca agccgtcaaa       840
     tctacccatg gtttgctcac cactgtcgcg ataggtgcag attgtgaagt gaattatgcc       900
     ttagagggcg ccgttttcat gggaggcgcg acgattcaat ggctcagaga tgaactgggc       960
     ctcatcaggg acgcacaaga taccgagtat tttgcctcaa aggtggaaga tactaatggg      1020
     gtctatttag tcccggcttt tgttggctta ggagcgccat actgggatcc caacgctcgt      1080
     ggtgctctgg ttgggttaac ccgtggctcg aatcgtaacc atattatccg cgccgctttg      1140
     gaagctattg cttatcaaag ccgtgatctg ctcgatgcca tggccaaaga tagcggtgtc      1200
     atgctcaagc agttaaaggt cgatggtggg gccgtctcta acgatttttt gatgcagttt      1260
     caggctgaca tcaccaatgt agaagtacag cggcctgcca ttactgaaac tacggctatg      1320
     ggggcggcat tccttgcagg attggccgtg ggattctgga gctcgacctc tgagctaaaa      1380
     cataaagccg atatcgagcg cacatttata ccatctatat cagctgagaa gtgtgatgag      1440
     ctgtattgtg ggtggaaccg cgccgtgact caaacgatta agagttga                   1488
//

If you have problems or comments...

PBIL Back to PBIL home page