(data stored in ACNUC7421 zone)

EMBL: CP000821.PE4

CP000821.PE4         Location/Qualifiers
FT   CDS_pept        complement(3859..4221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0004"
FT                   /product="ribonuclease P protein component"
FT                   /note="KEGG: sfr:Sfri_4065 ribonuclease P protein
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34617"
FT                   /db_xref="GOA:A8FP44"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP44"
FT                   /protein_id="ABV34617.1"
FT                   /translation="MQVTSYTFTRELRLLTPAQFKSVFTKPIKASSAEITLLAIPNSEQ
FT                   HPRLGLTVAKRFVKKAHQRNRIKRIIRDNFRLHQHELPPIDIVVLVRNGVVEMENTDLH
FT                   KLVEKLWRKLNRRYNG"
     atgcaagtga ctagctatac ctttacgcgg gagttacgtt tgttaactcc cgcgcaattc        60
     aaatctgtat tcacaaaacc catcaaagct tcttcggctg aaataacctt acttgctatt       120
     cctaactctg aacaacatcc tcgtttggga ttgactgttg ctaagcgttt tgtaaagaaa       180
     gcccatcagc gaaacagaat taaacgtatc atcagagata actttcgttt gcatcagcac       240
     gaactgcctc ctatcgatat agtcgtactc gtcagaaatg gcgtggtaga gatggaaaat       300
     acagatctcc ataaattggt agaaaagcta tggcgaaaac tcaatcgccg ttacaatggc       360
     tag                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page