(data stored in ACNUC7421 zone)

EMBL: CP000821.PE40

CP000821.PE40        Location/Qualifiers
FT   CDS_pept        47275..47838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0040"
FT                   /product="DNA topoisomerase, type IA, Zn finger domain
FT                   protein"
FT                   /note="KEGG: slo:Shew_3731 DNA topoisomerase, type IA, Zn
FT                   finger domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34653"
FT                   /db_xref="GOA:A8FP80"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP80"
FT                   /protein_id="ABV34653.1"
FT                   /translation="MSKIDQQLFSSHEHALEKEFELCPKCGCELSIKNSKHGGFIGCNN
FT                   YPTCDYTRPLVQHESIETQVIEGSQCPECGHELAVKSGRFGIFIGCTQYPECKHIEKQD
FT                   QEVGGEEIPCPICTKGHIEHRTNRFGKSFYACSGYPKCKFLVNYPPVHETCPDCGFGIL
FT                   VERKGAAGARLECPKKQCKYKRAL"
     atgtctaaga tcgatcaaca gctatttagt tcccatgagc atgcactcga gaaagagttt        60
     gagctttgtc caaaatgtgg ctgtgaacta tcgataaaaa atagtaaaca tggtggtttc       120
     atcggctgta ataactatcc gacctgtgat tatacccggc cactggtaca acacgagtcg       180
     atagaaaccc aggtgattga gggatctcaa tgtcctgagt gtggacacga gttagctgta       240
     aagtctggac gatttggcat tttcatcggt tgtactcaat atcctgagtg taaacatatc       300
     gagaaacaag accaagaggt gggaggggaa gagatacctt gccccatctg tactaaaggc       360
     catattgagc atagaaccaa tcgtttcggc aaaagcttct atgcatgtag tggctaccct       420
     aagtgtaagt ttctggttaa ttaccctcca gtgcatgaaa cctgtcccga ctgtggtttt       480
     ggtattttgg ttgaacgtaa gggagcggct ggggcacgtt tagaatgccc gaaaaagcaa       540
     tgtaagtata agcgcgccct atag                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page