(data stored in ACNUC7421 zone)

EMBL: CP000821.PE400

CP000821.PE400       Location/Qualifiers
FT   CDS_pept        complement(468533..468835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35013"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ90"
FT                   /protein_id="ABV35013.1"
FT                   /translation="MVGLDSLYAMLARPVPPVIKRKRVVEETEYMKGIAADSHEAPQSQ
FT                   LPPSLERRHAIEDRRDSPRGDRRGQKEKEKEQEEELAKAQQEAIESPLPHIDIDV"
     atggttggtt tagacagtct atacgccatg ctggctcgcc ccgttccgcc agtgataaag        60
     cgaaagcggg tcgttgaaga gacagaatac atgaaaggta ttgcggcaga cagccatgag       120
     gcccctcagt cacaacttcc accaagcctt gaacgtcgcc acgcaattga agaccgacgc       180
     gactcaccgc ggggcgatcg ccgtggccaa aaagaaaagg aaaaagagca agaggaagag       240
     ttagctaaag cgcagcaaga agccatcgag tctccccttc cccatatcga tattgatgtt       300
     taa                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page