(data stored in ACNUC7421 zone)

EMBL: CP000821.PE401

CP000821.PE401       Location/Qualifiers
FT   CDS_pept        469277..469735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0401"
FT                   /product="MraZ protein"
FT                   /note="KEGG: slo:Shew_3462 MraZ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35014"
FT                   /db_xref="GOA:A8FQ91"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ91"
FT                   /protein_id="ABV35014.1"
FT                   /translation="MFRGASAINLDTKGRIAIPKRYREPLHAEFNSQIVITVDFQSPCL
FT                   LLYPFDEWSKIEAKLLLLSDTRATERAMKRLLLGYAHECELDGNGRILLPPPLRQYANL
FT                   EKRAMLVGQLNKFELWDETAWQKQIEQSRETIQSEEFADNERLADFSL"
     gtgtttcgtg gggccagtgc tattaacctt gatacaaaag gacggatcgc tattccaaag        60
     cgctaccgtg agcccctgca cgctgaattt aatagccaaa tagtgataac cgttgatttt       120
     caatctccct gcctcttgct ctatccattc gatgaatgga gtaagatcga agcaaaatta       180
     ctactactct ccgatacccg ggctacagaa agagccatga aaaggctact tttgggctat       240
     gcccatgagt gtgagctcga tgggaacggt agaatattac tacctccacc gcttcgtcaa       300
     tatgccaatt tagagaagcg agcaatgtta gtggggcagt tgaataagtt tgaactttgg       360
     gatgaaactg cttggcagaa gcagatagag caaagccgag agacgattca aagcgaagag       420
     tttgctgata atgaacgtct tgccgatttc tcactgtga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page