(data stored in ACNUC7421 zone)

EMBL: CP000821.PE403

CP000821.PE403       Location/Qualifiers
FT   CDS_pept        470784..471098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0403"
FT                   /product="cell division protein FtsL"
FT                   /note="KEGG: slo:Shew_3460 cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35016"
FT                   /db_xref="GOA:A8FQ93"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ93"
FT                   /protein_id="ABV35016.1"
FT                   /translation="MSKSQLNLPRIVLLDLWHHKWVLLLAIAVMVNAIAVVYTSHVSRK
FT                   YITQWDQMLQERDRLDIEWRNLLLEEQSQSEHSRITRIASKELEMSRPLPKEEIVVRVP
FT                   "
     ttgagtaaat ctcaattgaa tctgcctcga atcgttttac tcgacttgtg gcatcacaag        60
     tgggtgttgt tactcgcaat agccgtaatg gtgaatgcca ttgctgttgt atacacaagc       120
     cacgtgagcc gcaagtacat cactcagtgg gatcagatgc tgcaagagcg ggataggttg       180
     gacattgaat ggcgtaattt acttcttgag gagcagtctc agtctgagca cagccggatc       240
     acgcgtattg cgagcaaaga gctcgagatg agccggccac tgcctaaaga agagattgtg       300
     gtaagagtgc catga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page