(data stored in ACNUC7421 zone)

EMBL: CP000821.PE409

CP000821.PE409       Location/Qualifiers
FT   CDS_pept        478235..479467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0409"
FT                   /product="cell division protein FtsW"
FT                   /note="KEGG: slo:Shew_3454 cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35022"
FT                   /db_xref="GOA:A8FQ99"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ99"
FT                   /protein_id="ABV35022.1"
FT                   /translation="MRSEERQLNLFGTSVNWSWPNLFKEREAPGMQLYDRALLFAVLSL
FT                   ICFGFVMVMSASMPEAQSLTGNPYHFAIRHFAYLVGCAVIAAVVLRIEMSRWQQFSPLL
FT                   LLIVGIMLVAVLLVGTSVNGATRWLSVGPIRIQVAELAKFAFTIYMAGYLVRRHQEIRE
FT                   NAKGFYKPIAVFAVYAFLILMQPDLGTVVVLFVGTVGLLFLAGARLLDFFALILTGVMA
FT                   FVALVLLEPYRMRRVTSFMDPWQDPFGSGYQLTQSLMAYGRGDWFGQGLGNSIQKLEYL
FT                   PEAHTDFIFAVIGEELGFIGIVVVLSVLLFVALRAIKLGNLCIEIDKPFEGYLAYAIGI
FT                   WFCFQTVVNVGASIGMLPTKGLTLPFISYGGSSLWVMTAAAMILIRIDHERRLSSIQAV
FT                   QGKKVNDNREY"
     atgcgtagcg aagagagaca actcaactta tttggcacca gtgtgaattg gagttggcca        60
     aatttgttta aagagcgaga agctcccggc atgcaattat atgaccgcgc cttacttttt       120
     gctgttttgt ctctgatctg ctttgggttt gtgatggtga tgtctgcttc aatgcctgaa       180
     gcacaaagcc tgacaggtaa cccttatcat tttgctatca ggcattttgc ctaccttgtg       240
     ggttgcgcag ttatcgctgc cgtggtgttg cgtatcgaga tgagccgttg gcaacagttc       300
     agcccgctac tgctattgat cgtaggcatt atgttagtcg ccgtactgct tgtggggacg       360
     tcggtgaatg gtgcgacccg ctggttatcc gtggggccga ttcgaataca ggtggctgaa       420
     ctggctaagt ttgcctttac catctacatg gcggggtatt tagtcagacg tcatcaggag       480
     atacgggaaa acgctaaggg gttctacaaa ccgattgccg tatttgcggt ttatgcgttt       540
     ctgatcttga tgcaacccga tttaggtaca gtcgtggtgt tatttgtggg aacggttggc       600
     ttacttttct tagccggagc tcgcttgctg gacttttttg ccttgatatt gactggagtg       660
     atggcatttg tggccttggt gcttttagag ccctatagga tgcgccgagt cacctctttt       720
     atggatccct ggcaagatcc gttcggcagc ggttatcagc taacccaatc tttgatggct       780
     tatggacgag gcgattggtt cggacaaggt ttaggcaata gtattcagaa attagagtac       840
     ctgcccgaag cccatacgga ctttatcttt gccgttatcg gcgaagagtt aggttttatt       900
     ggcatcgttg tggtgctgtc ggtgctgctt tttgtggccc ttagagcgat aaaattaggc       960
     aatttatgta ttgagataga taagcccttc gaaggttacc ttgcttatgc catcggtatt      1020
     tggttctgtt ttcagacagt agtgaatgtg ggtgcaagta ttggaatgct accgacgaag      1080
     gggctcactc taccttttat tagttatgga ggcagtagtc tctgggttat gaccgccgca      1140
     gctatgatat tgatccgcat cgatcatgag cgacgtttga gctctattca agctgtgcag      1200
     gggaaaaaag ttaatgacaa ccgtgaatac tga                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page