(data stored in ACNUC7421 zone)

EMBL: CP000821.PE41

CP000821.PE41        Location/Qualifiers
FT   CDS_pept        47939..48496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0041"
FT                   /product="SUA5/YciO/YrdC/YwlC family protein"
FT                   /note="KEGG: slo:Shew_3730 SUA5/YciO/YrdC/YwlC family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34654"
FT                   /db_xref="GOA:A8FP81"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP81"
FT                   /protein_id="ABV34654.1"
FT                   /translation="MLEQAPDEVQEIIEQGGVVAYPTEAVYGLGCDPDNDEAITRLLAL
FT                   KKRPWQKGLILVASDYQQLLPYIDESRLTNEQLNKVFVKWPGPFTFIMPIKPGLSNLLC
FT                   GSFNSLAVRVSSHPTIQAICQRLGKPLVSTSANHAGEPPAMSCEEIIAKFDGEIDALIS
FT                   GSLGAERKPSTIVDAISGKVLR"
     atgctggaac aggctccgga cgaggttcag gagattatcg aacagggcgg tgtcgttgca        60
     tatccgactg aagccgtcta tgggctaggc tgtgatcctg ataatgatga agcaataacc       120
     agattgcttg cattaaaaaa gcgcccctgg cagaaaggac ttatcttggt tgccagtgat       180
     tatcaacaac tactccccta tattgatgaa tcaaggctaa ccaatgagca gttaaacaag       240
     gtctttgtta agtggcctgg accatttacc tttatcatgc cgattaagcc cgggctctca       300
     aatttgttat gtggcagttt taactctctt gcggttagag tgtcttccca cccaacgatt       360
     caagccatct gtcagaggct tggtaagccg ttggtttcga ctagcgccaa tcatgccggc       420
     gaaccacctg cgatgagctg tgaagagatc attgccaaat ttgatggtga gatcgatgca       480
     ctgatatccg gctctcttgg agctgagcga aaaccttcaa caatcgtcga tgcgatcagt       540
     ggcaaagtgt tacgttag                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page