(data stored in ACNUC7421 zone)

EMBL: CP000821.PE412

CP000821.PE412       Location/Qualifiers
FT   CDS_pept        482148..482912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0412"
FT                   /product="polypeptide-transport-associated domain protein,
FT                   FtsQ-type"
FT                   /note="KEGG: slo:Shew_3451 polypeptide-transport-associated
FT                   domain protein, FtsQ-type"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35025"
FT                   /db_xref="GOA:A8FQA2"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQA2"
FT                   /protein_id="ABV35025.1"
FT                   /translation="MSWAEVGQRWKLRLVQVDWYLCLGLLFLLLVVISLSMGAWKLNLI
FT                   VNDADALPIEAVAIRGERARTSDEEIQVALQDLMKRSFFSADVNQVQDALEALPWVYQA
FT                   SVRREWPAKLKVYLVEQQVVAHWNGDAWLNIHGQIFDAPKRSDIGALPLLAGPEGQSKV
FT                   VLTTYRQVSELLKINGFKLDSLSLSPRHAWHGSLDNGIMLELGREDKMARIQRFINVYP
FT                   TLVKQSKPVAKVDLRYDTGLAVGWENAQKESQ"
     gtgtcttggg ctgaggttgg tcaaaggtgg aaattgaggc tggtgcaggt cgattggtat        60
     ctgtgtcttg ggctcctgtt tttgctcttg gtagtaatca gtttatcgat gggagcttgg       120
     aaacttaatc tgatagttaa tgacgccgac gcattgccta tcgaggctgt ggcaatcaga       180
     ggagagcgtg ccagaacctc tgatgaagag atacaggtcg cattacagga tctgatgaag       240
     agaagctttt tctcggcaga tgtcaatcaa gtgcaggatg cattagaggc gttgccctgg       300
     gtttaccagg cttcggtacg gcgtgaatgg cctgcaaagt taaaggtata cctggttgag       360
     caacaagtcg tcgcccattg gaatggagat gcctggctca atattcatgg gcagatattc       420
     gatgcaccta aaagatctga tattggggct ttgcctctgc ttgccggccc ggaagggcaa       480
     tcgaaagtgg tattaaccac atatcggcaa gttagcgagt tgttgaagat aaatggtttc       540
     aagttagaca gtctaagttt gagtccgaga catgcatggc atggttcatt ggataacgga       600
     attatgctcg agctaggcag agaagataaa atggcaagga tacaaagatt tatcaatgtg       660
     tatccgacac tggttaagca gtcaaagcca gttgccaagg tagatttgcg ctacgacacc       720
     ggattagccg taggttggga aaatgcacag aaagagagcc agtaa                       765
//

If you have problems or comments...

PBIL Back to PBIL home page