(data stored in ACNUC7421 zone)

EMBL: CP000821.PE413

CP000821.PE413       Location/Qualifiers
FT   CDS_pept        482916..484151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0413"
FT                   /product="cell division protein FtsA"
FT                   /note="KEGG: slo:Shew_3450 cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35026"
FT                   /db_xref="GOA:A8FQA3"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQA3"
FT                   /protein_id="ABV35026.1"
FT                   /translation="MTKNQDRNLIVGLDIGTSKVAVIIGEVLPDGEISVVGLGNHQSRG
FT                   MDKGGVNDLDSIVRSVQRALDQAELMADCQVSSVYLGISGKHIDCQNENGMVSINDEEV
FT                   TQDDVDNVIHTARSVKIPTERRILHVLPQEYAIDVQDGIKSPIGMSGMRMEAKVHIVTC
FT                   ANDMAKNITKSVERCGLKVDDLVFSAIASADSVLTNDEKDLGVCLVDIGGGTTDLAVYT
FT                   NGALRHCAVVPVAGNQVTNDIAKIFRTPLSHAEQIKVQFASARSAMVSREDSIEVPSVG
FT                   GRPSRTMSRHTLAEVVEPRYQELFELVLKELRDSGLEDQIAAGIVLTGGTSSIEGTVDV
FT                   AEATFGMPVRVATPLPVKGLFEYVDQPIYSTGVGLLHYGARRVVERQFERPERQGVTSL
FT                   WNRVQSWFKGEF"
     atgaccaaga atcaagatag aaatctgatc gttggattag acataggaac ctcaaaggtt        60
     gctgtgatca taggtgaagt gctacccgat ggtgagatca gtgttgtcgg gttagggaat       120
     catcagtcca gaggcatgga caaaggtggt gtaaacgatc ttgattctat tgtgcgcagt       180
     gtacagcgtg cgttagatca ggccgagtta atggccgatt gccaagtttc atcagtatat       240
     ttgggtattt ctggtaagca tatagattgt cagaatgaaa acggcatggt ctcaatcaat       300
     gatgaagagg tcacgcagga tgacgtcgac aatgtgattc acacggcgcg ttcggtaaaa       360
     attcctactg agcgccgcat attgcacgtg ttgccacaag aatatgcaat cgatgtacag       420
     gacggcatta agagccctat cggtatgtca ggtatgcgta tggaggcaaa ggttcatatt       480
     gttacatgcg cgaatgatat ggcaaaaaat attaccaaga gtgtcgagcg atgtggactc       540
     aaggtcgatg acttagtgtt ttctgccatt gcatctgctg actcagtttt gactaatgat       600
     gagaaggact taggtgtctg tctagtcgac atcggtggtg ggacaacaga tctggcggta       660
     tataccaacg gtgcattgcg tcattgcgct gtggtgccag ttgccggtaa tcaggtgact       720
     aacgatatcg cgaagatttt cagaacgcca ctttctcatg cggaacagat taaggttcaa       780
     tttgccagtg ctcgtagcgc catggttagc cgtgaagaca gtattgaagt tccttctgtc       840
     ggtggaaggc cgtccagaac catgtccaga catactttgg cagaagtggt tgagcctagg       900
     tatcaagagc tttttgaatt agtactgaaa gaattaagag actctggtct agaagaccag       960
     atcgcagctg gtatcgtcct aacaggtgga acatcctcca ttgaagggac ggttgatgtg      1020
     gctgaagcca catttggtat gccagtgaga gtagcaacac cactacctgt gaaagggtta      1080
     tttgaatatg tggatcagcc catatattcg accggggtag gcttgttaca ctatggagca      1140
     agaagggtcg tcgagcgtca gtttgagcgt cctgagcgtc aaggggttac cagtctttgg      1200
     aatcgggttc aaagctggtt taaaggtgag ttttaa                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page