(data stored in ACNUC7421 zone)

EMBL: CP000821.PE414

CP000821.PE414       Location/Qualifiers
FT   CDS_pept        484228..485403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0414"
FT                   /product="cell division protein FtsZ"
FT                   /note="KEGG: slo:Shew_3449 cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35027"
FT                   /db_xref="GOA:A8FQA4"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQA4"
FT                   /protein_id="ABV35027.1"
FT                   /translation="MFEIMDSHTDEAVIKVIGVGGGGGNAIEHMVKHNIEGVEFVATNT
FT                   DAQALRKSSAGSTIQLGRDITKGLGAGANPEIGRLAAEEDKENIRNAIKGSDMIFIAAG
FT                   MGGGTGTGAAPVVAEVAKEEGILTVAVVTKPFPFEGKKRMSYADQGIAELAKHVDSLIT
FT                   IPNEKLLKVLGRGTSLLDAFAAANNVLLGAVQGIAELITRPGLINVDFADVKTVMSEMG
FT                   NAMMGTGVASGEDRAEEAAEAAVASPLLEDIDLAGARGVLVNITAGMDMSIEEFETVGN
FT                   HVKAYASDNATVVVGAVIDPEMSDELRVTVVATGIGAEKKPDIQLVTKPAPRPEPIVTP
FT                   EVRPETASEEMIAQPMVTGNVVPVAQTAPAPAPKNEADYLDIPAFLRKQAD"
     atgtttgaga tcatggatag tcatactgat gaagcggtga ttaaggtcat cggtgtcggt        60
     ggcggtggtg gcaatgccat cgaacatatg gttaaacaca acatcgaagg tgttgagttt       120
     gttgcaacca atacagatgc acaagcatta agaaaatctt cagcaggatc aaccattcaa       180
     cttggacgtg atatcactaa agggttggga gcgggggcaa acccagaaat tggtcgcctg       240
     gcagccgagg aagataaaga aaatatcaga aatgccatta aaggttctga catgatcttt       300
     attgccgcgg gtatgggtgg cggtacgggt acaggtgctg cgccagttgt tgctgaagtt       360
     gctaaagaag aaggcatctt aaccgttgcc gtagtaacta agcctttccc gttcgaggga       420
     aagaagcgca tgtcttatgc cgatcaaggt atcgctgagc ttgccaagca tgtggattcg       480
     ttaattacca ttcctaacga gaaactactg aaagtattag gccgtggtac gtcattgtta       540
     gatgcttttg ccgcggcaaa taacgtattg ctgggtgctg ttcaaggtat cgcagaactg       600
     atcactcgac ctggtctgat caacgtggat ttcgccgacg tgaaaactgt gatgtcagag       660
     atgggtaatg ccatgatggg tacgggtgta gccagtggtg aagaccgtgc cgaagaagca       720
     gccgaagcgg ctgttgccag tcctttgctg gaagatatcg atcttgccgg ggctcgtggt       780
     gtacttgtta acattacggc cggtatggac atgagcattg aagagtttga gacagtgggt       840
     aatcacgtta aagcttatgc atctgataat gctacagtcg tcgtgggagc ggtaatcgat       900
     cctgaaatga gcgatgagtt gcgtgtgacc gtagttgcta ccggaattgg tgcagaaaag       960
     aagcctgata ttcagttggt gactaaacct gctccgcgtc cagagccaat agtgacacca      1020
     gaagttcgtc cagagacagc atctgaagag atgatagctc agccaatggt gacaggaaat      1080
     gttgtgccag ttgctcaaac tgcaccagca ccagcaccaa aaaatgaagc agattatctg      1140
     gatatcccag cattcttgcg taagcaggct gattaa                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page