(data stored in ACNUC7421 zone)

EMBL: CP000821.PE416

CP000821.PE416       Location/Qualifiers
FT   CDS_pept        complement(486566..487018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3447 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35029"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQA6"
FT                   /protein_id="ABV35029.1"
FT                   /translation="MKKPPQDLSQLLHQQGQMPNLAEKAELLLHLNHYVKQVLAGPVSQ
FT                   QLKVANLRQGVLVIETTSAAWAARINFQKAKILQQLQAETLPMLTAIEVKVNPSLVLYE
FT                   TKPKIPQHHISETAASHIEALAEHTEGSLAEKLKRLAALASRSRQS"
     atgaaaaagc ccccgcagga cctaagccaa ttactgcatc agcaagggca aatgcctaat        60
     cttgctgaaa aagcagaact tctattacac ttgaatcatt acgtgaaaca ggtgttagct       120
     ggtccggtgt cgcagcaact aaaagttgca aatcttcgac agggtgttct tgttattgaa       180
     acgacttcag ctgcatgggc cgcaagaata aacttccaaa aagccaaaat tttacaacag       240
     ctacaagccg aaacgctacc catgctcacc gctatcgaag ttaaagtcaa cccgagtctg       300
     gttttgtatg aaacaaagcc caaaatccct caacatcaca tcagcgaaac agctgcaagc       360
     catattgaag cattagccga acatacggag ggttctttgg cagagaaact aaaacggctg       420
     gctgcattag ccagccgttc aaggcaatct tag                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page