(data stored in ACNUC7421 zone)

EMBL: CP000821.PE418

CP000821.PE418       Location/Qualifiers
FT   CDS_pept        488005..490728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0418"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="KEGG: slo:Shew_3445 preprotein translocase, SecA
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35031"
FT                   /db_xref="GOA:A8FQA8"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQA8"
FT                   /protein_id="ABV35031.1"
FT                   /translation="MFGKILTKLFGSRNDRTLKSLGKTVTKINALEDEYEKLTDEELKA
FT                   KTTAFRGRLESGETLDDVMSEAFAVVREASKRVFEMRHFDVQMLGGMVLDSNRIAEMRT
FT                   GEGKTLTATLPAYLNGLTGKGVHVITVNDYLARRDAENNRPLFEFLGLSVGINVAGLGQ
FT                   QEKKAAYDADITYGTNNEFGFDYLRDNMAFSPQERVQRPLHYALIDEVDSILIDEARTP
FT                   LIISGAAEDSSELYTKINTLIPHLVRQDKEDTEEEIGDGDYSIDEKAKQVHMTERGQEK
FT                   VEVLLTERGMLAEGDSLYSAANISLLHHVNAALRAHTLFEKDVDYIVQDNEVIIVDEHT
FT                   GRTMPGRRWSEGLHQAVEAKEGVHIQNENQTLASITFQNFFRQYEKLAGMTGTADTEAF
FT                   EFQHIYGLDTVVIPTNRPMVRKDHADLVYLTPDEKYAAIIEDIRGCRERGQPVLVGTVS
FT                   IEQSELLARLMKQEKIPHEVLNAKFHEREADIVAQAGRTGAVTIATNMAGRGTDIVLGG
FT                   NWAMEIEVLTNPTDEQKAKIKTDWQVRHDEVVAAGGLHILGTERHESRRIDNQLRGRSG
FT                   RQGDAGSSRFYLSMEDSLMRIFASDRVSSMMKKLGMEKGEAIEHPWVSRAIENAQRKVE
FT                   ARNFDIRKQLLEFDDVANDQRQVVYAQRNELMDAESIQDTIVNIQADVVNGLVDQYIPQ
FT                   QSVEELWDVPGLQTRLEQEYGLKMPVQEWLDKEDDLHEETLRERIVDTWVKSYQAKEEM
FT                   VGEQVLRQFEKAVMLQTLDGLWKEHLAAMDHLRQGIHLRGYAQKNPKQEYKRESFELFQ
FT                   QMLETLKHDVISVLSKVQVQAQSDVEEMEERRRQEDAKIQRDYQHASAEAIVGAEEAES
FT                   LSAHTPVVREGEKVGRNDPCPCGSGRKYKQCHGKLT"
     atgtttggta aaatactgac aaaattattt ggtagtcgta acgatcgcac acttaaatct        60
     cttggcaaaa ctgtcacaaa gattaatgca cttgaagatg aatatgaaaa gctgactgac       120
     gaagagttaa aggctaagac tactgccttt cgtggtcgtt tagagtctgg tgagacttta       180
     gatgatgtga tgtctgaagc ttttgccgtt gtacgcgaag cgtctaagcg tgtttttgaa       240
     atgcgtcatt tcgatgttca aatgctgggt ggtatggtac tggatagtaa ccgtatcgct       300
     gagatgagaa cgggtgaagg taaaacactt accgcaacac taccggctta tctgaatggt       360
     ttgacgggta aaggtgttca cgttattacg gtcaatgact atttggcacg tcgtgatgct       420
     gagaacaacc gtccgctttt tgagtttctt gggctctctg ttggtattaa tgtcgcgggt       480
     cttggccagc aagagaagaa agctgcctac gatgccgata ttacttatgg tactaacaac       540
     gaatttggtt tcgattatct tcgtgacaac atggcctttt cgccacaaga gcgtgttcaa       600
     cgcccacttc actatgcact gatcgatgaa gtcgattcga ttcttatcga tgaagcaaga       660
     acgccattga tcatctcagg tgccgcagaa gacagctctg agctctatac caaaattaat       720
     acccttattc cgcatcttgt ccgtcaagac aaagaagata cggaagagga gatcggcgat       780
     ggtgattact ctatcgacga gaaggctaaa caagttcaca tgactgaacg tggacaagag       840
     aaagttgaag tgctgcttac cgaacgcgga atgttggccg aaggtgactc tctatattca       900
     gctgcaaata tctctctatt gcatcatgtt aatgccgcgc tgcgtgctca tactcttttc       960
     gaaaaagatg ttgactatat cgtccaggat aacgaagtta tcattgtcga tgagcatacc      1020
     ggtcgtacta tgccgggtcg ccgttggtct gaaggtcttc atcaagcggt agaagcgaaa      1080
     gaaggcgttc atattcaaaa tgaaaaccaa actcttgcat ctattacttt ccagaacttc      1140
     ttccgccaat atgagaagtt agcgggaatg acaggtacag ccgatactga agcgttcgaa      1200
     ttccaacaca tctatggatt agatacggta gttattccaa ccaacagacc tatggttcgt      1260
     aaagaccatg ccgatctcgt gtatttaact cctgatgaga aatacgctgc gattattgaa      1320
     gatattcggg gctgtcgtga acgtggtcag ccagtgcttg tgggtaccgt ttcaattgag      1380
     caatcggaac tgcttgcacg attaatgaag caagagaaga tccctcacga agtattgaac      1440
     gcaaaattcc atgaacgtga agccgatatc gttgcccaag cgggtcgaac cggtgcggta      1500
     accattgcca ccaacatggc gggtcgtggt accgatatcg tactcggtgg taactgggcg      1560
     atggagatcg aggttcttac taacccaact gatgaacaga aagccaagat taaaacagac      1620
     tggcaggttc gccatgacga agtcgttgct gctggtggat tgcatatcct gggtacagag      1680
     cgtcatgagt ctcgccgtat cgataaccag ttacgtggtc gttctggtcg tcaaggtgat      1740
     gccggctctt cacgcttcta cctttcaatg gaagatagcc tgatgcgtat ctttgcttca      1800
     gaccgtgtct cttcaatgat gaagaagtta ggtatggaga aaggtgaggc gatagagcac      1860
     ccttgggttt ctcgagctat tgaaaacgca caacgtaaag ttgaagcgcg taacttcgat      1920
     attcgtaagc agttacttga gtttgatgat gtagccaacg atcagcgtca agttgtctat      1980
     gcacagcgaa atgaactgat ggatgctgag agtatccagg acactatcgt taatattcag      2040
     gccgatgtgg ttaatggtct cgtcgatcaa tatattcctc agcaatctgt tgaggaacta      2100
     tgggatgtac ctggcttaca aacacgtctg gagcaagagt acgggttgaa aatgccagtg      2160
     caggagtggc tggataaaga agatgatctt catgaagaaa cgcttcgtga gcgaattgtc      2220
     gatacttggg tgaaatcata ccaagctaaa gaagagatgg ttggcgagca agttctacgt      2280
     caatttgaaa aagctgtcat gctacaaaca ctcgacggtt tgtggaaaga gcatttggct      2340
     gccatggatc atctgcgtca aggcattcat cttcgtggct atgcacagaa gaacccaaag      2400
     caggaataca agcgtgaatc gtttgagctg ttccagcaga tgttagaaac actgaaacac      2460
     gatgtcatca gtgttctatc taaggttcaa gtacaagctc agtcagatgt agaagagatg      2520
     gaagaacgcc gccgccagga agatgccaaa atccaacgtg attaccaaca tgcttcagca      2580
     gaagctatag tcggagctga ggaagctgaa tctttgtctg cacacactcc ggttgtgcgg      2640
     gaaggtgaaa aggttggccg taatgatcct tgtccatgtg gttcagggcg taagtataag      2700
     cagtgtcacg gcaagctgac ataa                                             2724
//

If you have problems or comments...

PBIL Back to PBIL home page