(data stored in ACNUC7421 zone)

EMBL: CP000821.PE419

CP000821.PE419       Location/Qualifiers
FT   CDS_pept        complement(512380..512769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0419"
FT                   /product="mutator MutT protein"
FT                   /note="KEGG: slo:Shew_3444 mutator MutT protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35032"
FT                   /db_xref="GOA:A8FQA9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQA9"
FT                   /protein_id="ABV35032.1"
FT                   /translation="MKRIHVAVGVVLNNQNQVLLAKRPSHLHQGGKWEFPGGKVESGET
FT                   GSQALIRELREEVNLIVIATSPLMTISHDYPDKEVLLDIHTVNGYSGLAEGLEGQQVLW
FT                   ANVDKLGEYDFPEANTPIIDKLQSL"
     atgaagcgga tacatgtcgc cgtaggcgta gtccttaaca atcaaaatca ggtattgtta        60
     gccaaacgac cgtctcactt acaccaaggt ggcaagtggg agtttcctgg aggcaaggtt       120
     gaaagcggtg agactggttc acaagcattg attagagagc ttagagaaga ggtaaacctt       180
     atcgtcattg ctacaagccc cttaatgacg atctcacatg attatcctga caaagaagta       240
     ctcttagaca tccatacggt aaatggctat tcaggtcttg ctgaagggct ggaaggacag       300
     caggtgttat gggcaaatgt agataaatta ggagagtatg atttccctga agctaacact       360
     ccaataatcg acaaactaca gtctctttaa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page