(data stored in ACNUC7421 zone)

EMBL: CP000821.PE420

CP000821.PE420       Location/Qualifiers
FT   CDS_pept        complement(512773..512985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0420"
FT                   /product="protein of unknown function DUF329"
FT                   /note="KEGG: slo:Shew_3443 protein of unknown function
FT                   DUF329"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35033"
FT                   /db_xref="GOA:A8FQB0"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQB0"
FT                   /protein_id="ABV35033.1"
FT                   /translation="MTTTVKCPTCQKEVIWNSESKFKPFCSDRCKLIDLGDWASEKHAI
FT                   PVKSEFDPETLDGLGYDEADFFKDQ"
     atgacaacaa cagtgaaatg tccaacctgc caaaaagaag tcatttggaa cagcgagtct        60
     aaatttaagc ctttctgtag cgatagatgt aaacttattg acttgggaga ttgggcctca       120
     gaaaagcatg caattccagt taagtccgaa tttgatcctg aaaccctaga tggcttaggc       180
     tacgatgaag ctgacttctt taaggatcaa taa                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page