(data stored in ACNUC7421 zone)

EMBL: CP000821.PE421

CP000821.PE421       Location/Qualifiers
FT   CDS_pept        complement(513065..513799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0421"
FT                   /product="protein of unknown function DUF1342"
FT                   /note="KEGG: slo:Shew_3442 protein of unknown function
FT                   DUF1342"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35034"
FT                   /db_xref="GOA:A8FQB1"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQB1"
FT                   /protein_id="ABV35034.1"
FT                   /translation="MTELIYEQPLNEKTRSYLRLEYLEQQLQTNLAHDHQHRCFYPLFS
FT                   LCELTERCDYRGEVLKDIDKQILQLSNWQNLPHIDSRQVSIYLSKLADAREALSVCERP
FT                   GSQLKLNRFLAALRQRFNMPGACCNFDLPQLHYWLAKPWDIRQYEYSEWIGHFTALLVP
FT                   IKLLLDLTRQTTEYSNAVATAGFFQGNSNQALSLIRVKLDSQQGCYPTISGHKNRYAIH
FT                   FVQFDQQKHSDRSIEFKLATCS"
     atgactgaac taatttatga acagccttta aatgaaaaaa caagaagcta tttgcgacta        60
     gaatatctag aacagcaact acaaacaaat ttagctcatg atcatcagca tagatgtttc       120
     tatccacttt tttctctgtg cgaattaacc gaacgctgtg attatcgtgg cgaagtatta       180
     aaagatattg ataaacagat ccttcaactc tctaactggc aaaacctacc tcatattgac       240
     tctaggcaag ttagtattta cttgtccaaa cttgcggatg caagagaagc cctaagtgtt       300
     tgtgagaggc caggaagcca gcttaaactc aatcgctttc ttgctgcatt acgccaaaga       360
     tttaatatgc cgggcgcttg ctgtaacttt gaccttcctc aactccacta ctggcttgca       420
     aaaccatggg acattcgcca gtatgaatac tctgagtgga ttggtcattt taccgccttg       480
     ctcgtcccca ttaagttact gctggaccta accagacaaa ccaccgaata tagcaatgca       540
     gtagccacag ctggtttttt tcaaggaaac agcaatcaag ccttatcctt aatcagagtc       600
     aaactagact cccaacaagg atgctatcct acaatcagcg gtcataaaaa tcgttacgcc       660
     atccattttg tacaatttga ccaacagaaa cattctgata gaagcataga attcaaatta       720
     gccacctgtt cttaa                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page