(data stored in ACNUC7421 zone)

EMBL: CP000821.PE422

CP000821.PE422       Location/Qualifiers
FT   CDS_pept        complement(513808..514413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0422"
FT                   /product="Dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="KEGG: slo:Shew_3441 dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35035"
FT                   /db_xref="GOA:A8FQB2"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQB2"
FT                   /protein_id="ABV35035.1"
FT                   /translation="MSKFIVGLTGGIGSGKTTVANMFAELGVELVDADIIAREVVEVGS
FT                   KGLNEISAHFGNTILNKDKSLNRATLRELIFSQPDERQWLNDLMHPMIRSKILKCIEST
FT                   TSPYAILVAPLLFENGLDRLVNLSLLVDISPEQQLDRTIDRDSVSSEQIKNIIDSQAPR
FT                   AERLSKADDVIDNHGKISALKGKVITLHNNYLKLANNT"
     atgtcaaagt ttatagttgg cctgacgggc ggtattggta gcgggaaaac aaccgttgcc        60
     aatatgttcg ccgagttagg cgttgagctt gtcgatgcag atattattgc tcgagaggtg       120
     gtcgaggttg gatccaaagg gctaaatgag attagtgctc actttggaaa cacaatacta       180
     aacaaggata aaagcctaaa tagggccaca ctcagagagc tcatttttag tcagcccgat       240
     gaacgacaat ggctaaacga tctgatgcac cccatgatca ggagtaagat actaaaatgt       300
     attgaatcca ccacttcacc ctacgctatt ttggttgctc ccttgctatt tgagaatggt       360
     ttagataggt tagtaaactt atctcttctg gttgatattt cacctgaaca gcaattggac       420
     agaacaattg atagagattc tgtttcttca gaacaaatta aaaacataat agatagtcag       480
     gctcccagag ctgaaagact atcgaaggct gatgatgtca tagacaatca tggaaagata       540
     tcggcactaa aagggaaggt cattacacta cataataatt atttgaaatt agccaataat       600
     acttaa                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page