(data stored in ACNUC7421 zone)

EMBL: CP000821.PE423

CP000821.PE423       Location/Qualifiers
FT   CDS_pept        complement(514459..515370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0423"
FT                   /product="Prepilin peptidase"
FT                   /EC_number="3.4.23.43"
FT                   /note="KEGG: shn:Shewana3_0417 peptidase A24A domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35036"
FT                   /db_xref="GOA:A8FQB3"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQB3"
FT                   /protein_id="ABV35036.1"
FT                   /translation="MSEFISILSQNLWLFSIISFIFSAVIGSFLNVVIHRFPVMLKREW
FT                   QQECNQYLNEYHEKLIAPISEQLNNPIDDYPERYNLVVPASACPKCKTNIKPWHNLPIV
FT                   GWLMLKGKCAACGTSISPRYPIIELLTGLAVALLAYHFGPGWEFIFATVLTFVLIALTG
FT                   IDLDEMLLPDQLTLPLLWLGLLINLNGTFASPTDAMIGAAAGYLSLWSVFWAFKLLTGK
FT                   EGMGYGDFKLLAVFGAWFGWQMLPLIILLSSLVGAIVGIGLIVTKKINKTNPIPFGPYI
FT                   AAAGWIAMIWGSDITNWYLSTL"
     atgtcagaat ttatctccat attgagccag aacctttggc tcttcagtat tatcagtttt        60
     attttttcgg ctgtcatagg cagttttctt aatgtggtaa tacaccgctt ccccgtcatg       120
     ttaaagcgtg aatggcagca agagtgtaat cagtatttga acgaatacca cgaaaagctg       180
     atagcgccca tttcggagca acttaacaat cccatcgatg actaccccga gagatacaat       240
     ttagtcgttc ctgcttctgc atgcccgaag tgtaaaacaa acatcaaacc atggcacaac       300
     ctaccgattg tcggttggct gatgctgaaa ggaaaatgtg cggcgtgtgg taccagtatt       360
     tcgcccagat atccaattat cgagctcctc accgggctgg ctgtagcatt gcttgcatat       420
     catttcgggc ctggctggga attcattttt gcgacggtac tgacatttgt tttaatagcc       480
     ctaacaggta ttgatctgga tgaaatgtta ctgccagatc agctcaccct tcctctactc       540
     tggcttggct tactgataaa tctgaatggt acctttgcgt caccgaccga tgcaatgatc       600
     ggtgctgcgg ctggctattt aagcctctgg agtgtcttct gggcctttaa gcttttaacg       660
     ggtaaggaag gcatgggata tggtgatttt aaactattag ccgttttcgg agcctggttt       720
     ggttggcaga tgttaccact cattatttta ttatcatcgc tggttggcgc aatagtcggt       780
     ataggcttga tagtaaccaa gaagataaat aaaactaacc caattccttt cggcccatat       840
     atagcagcag caggttggat cgccatgatc tggggctccg atattacaaa ctggtacctt       900
     tctacactgt aa                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page