(data stored in ACNUC7421 zone)

EMBL: CP000821.PE424

CP000821.PE424       Location/Qualifiers
FT   CDS_pept        complement(515443..516708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0424"
FT                   /product="type II secretion system protein"
FT                   /note="KEGG: slo:Shew_3439 type II secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35037"
FT                   /db_xref="GOA:A8FQB4"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQB4"
FT                   /protein_id="ABV35037.1"
FT                   /translation="MATATAGKAKKSKKKSAKAQPKVFTFEWKGVNRDGKKTSGELRGT
FT                   SAIEIKSQLKLQGVKPKAVRKKANSLFKSEKKITAMDIAMMTRQVATMLSAGVPIVTTL
FT                   ELLGRGHEKPKMRELLATIVGDVQSGIPLSDSLKPHRQYFDDLYVDLVAAGEHSGSLDA
FT                   VFDRIATYREKAEALKSKIKKAMFYPAAVVVVAIAVTALLLLFVVPQFEEIFQGFGAEL
FT                   PAFTQMIVDISRWLQASWYIFVIAIIIAVFSFKRAHLHSQSFRNRVDEFVLKIPAIGDI
FT                   LDKGAMARFARTLSTTFAAGVPLIDGLESSAGASGNYVYRSALLKVRQEVMAGMQMNVA
FT                   MRTTGLFPDMLIQMVMIGEESGGLDEMLNKVANIYEMQVDDAVDGLSSLIEPIMMVVIG
FT                   TLVGGLIVGMYLPIFQMGNVVG"
     atggcaacgg cgacagcagg caaagcaaaa aaatcaaaga aaaagagtgc taaagcccaa        60
     cctaaggttt tcaccttcga gtggaaggga gttaatcgcg atggaaaaaa aacctctggc       120
     gagttaagag gaacctccgc aatagagata aagagtcagc taaaactcca aggcgttaaa       180
     ccaaaagctg tccgtaaaaa agcaaactca ctcttcaaga gtgaaaagaa aattacagcc       240
     atggacattg ctatgatgac caggcaggtt gccaccatgc tctcagcagg tgttccgatt       300
     gtcacaacgc tagaattact gggtcgtggc catgaaaagc ctaaaatgcg agagttacta       360
     gcgacgattg taggtgatgt ccaatcaggt atcccccttt ctgattcact caaaccccat       420
     agacaatatt tcgatgatct atatgtcgat ttggttgcag cgggtgaaca ttctggctca       480
     ctcgatgccg tatttgatcg cattgccacc taccgagaga aagccgaggc gttaaagtca       540
     aaaatcaaga aagccatgtt ttaccccgct gcagttgtag tggttgcgat agcggtgacc       600
     gccctacttt tactttttgt tgtgcctcag tttgaagaga tctttcaagg ctttggcgcg       660
     gaattacctg cctttacgca gatgattgtt gatatttctc gatggttgca agcctcttgg       720
     tatatttttg ttatagcgat aattattgca gtattcagct tcaaacgcgc tcatctacac       780
     tcacagagct ttaggaacag ggtcgatgaa tttgtattaa aaatccctgc tataggcgat       840
     atactcgata aaggtgctat ggctcgcttt gctagaactc tctcaacaac tttcgcagcg       900
     ggagttccgc taattgacgg cttagaatcc tctgcgggag cttcaggtaa ctatgtttat       960
     cgaagcgctc tacttaaagt gcgccaagaa gtgatggcag gtatgcagat gaatgttgct      1020
     atgcgcacaa caggtctgtt tcctgacatg ctgatccaga tggtaatgat cggtgaagag      1080
     tctggcggac tcgatgagat gctcaataaa gtcgctaaca tctatgagat gcaggtcgat      1140
     gatgccgtcg atggcctttc cagcttaatt gagcctatca tgatggttgt catcggcaca      1200
     ctcgttggcg gcctgattgt cggcatgtat ctaccaatct tccaaatggg taatgtggta      1260
     ggctag                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page