(data stored in ACNUC7421 zone)

EMBL: CP000821.PE426

CP000821.PE426       Location/Qualifiers
FT   CDS_pept        complement(518556..518966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0426"
FT                   /product="methylation site containing protein"
FT                   /note="KEGG: sfr:Sfri_3782 methylation site containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35039"
FT                   /db_xref="GOA:A8FQB6"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQB6"
FT                   /protein_id="ABV35039.1"
FT                   /translation="MKGLNLNKSMKNAKGFTLIELMIVVAIIGILAAIALPAYKDYVAK
FT                   ADASAGVGTLAGSKTKVSEVYSIDGSIGCTDSNGDGIPYCAAADGILATQNEAGTVIIT
FT                   LTPDIASTPGSIEWGCVLSGANAVAIKGCTAP"
     atgaaaggtc ttaacttgaa caagagtatg aaaaacgcta agggtttcac ccttattgaa        60
     ttaatgatcg ttgttgcaat catcggtatt ctcgccgcaa ttgcactacc tgcttataaa       120
     gattatgtag ctaaagctga tgcatcagct ggtgttggta cgctagcagg ttcaaaaact       180
     aaagtatcag aggtatactc aattgatggt agcataggtt gtactgattc taatggtgat       240
     ggtatccctt actgtgctgc cgccgatggc atattagcga ctcagaacga agctggtact       300
     gttattatta ccttaactcc tgatattgcg tcaactcctg gcagtattga gtggggttgt       360
     gtgctatccg gcgctaacgc cgttgcaatt aaaggctgta cagcgcctta a                411
//

If you have problems or comments...

PBIL Back to PBIL home page