(data stored in ACNUC7421 zone)

EMBL: CP000821.PE430

CP000821.PE430       Location/Qualifiers
FT   CDS_pept        522956..523708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0430"
FT                   /product="regulatory protein GntR, HTH"
FT                   /note="KEGG: shn:Shewana3_0425 regulatory protein GntR,
FT                   HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35043"
FT                   /db_xref="GOA:A8FQC0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQC0"
FT                   /protein_id="ABV35043.1"
FT                   /translation="MAYSKINQPKISDVIMGQLEQMILEGSLQPGQKLPPERELALQFE
FT                   VSRPSLREAIQKLEAKGLLLRRQGGGTYVKEQLWQSLADPIVELMHSDSESQYDLLEFR
FT                   HATEGMMAYFAALRGTDADMQNIKRTIMEVDAASEIEQQAEAIVKFYRAVAEASHNVAM
FT                   LHLVLSLAPVLHKNVAQNLELLNRREEASKMANDHRLALLAAIVRRDPEAAREASNEHL
FT                   SYIEEVMLSVREEDSRLQRSLRRLKSGV"
     atggcttata gcaaaataaa ccagccaaaa atttctgacg tcatcatggg acagttagaa        60
     cagatgatcc tggaaggaag tctccagcct ggtcagaaac taccccctga acgcgaactt       120
     gcactgcagt tcgaagtttc ccgtccctca ttacgagaag ccattcaaaa gcttgaagcc       180
     aaaggtctac tcttgcgtcg tcaaggtggt ggcacctatg tcaaagagca gctttggcag       240
     agcctggcag atcctatcgt cgagttgatg catagtgact ccgagagtca gtatgatcta       300
     ctcgagtttc gtcatgctac cgaaggcatg atggcatatt ttgcggcgct acgtggtacc       360
     gacgccgata tgcagaatat caagcgcacg attatggaag ttgatgctgc atctgaaatt       420
     gagcagcaag cggaagctat tgtaaaattc taccgtgcgg tcgccgaagc ctctcataac       480
     gtggctatgc tacaccttgt cttaagttta gcccctgtgc tgcataaaaa cgtggcacag       540
     aacctggagc ttctgaaccg aagagaggaa gcctccaaaa tggccaacga tcataggctg       600
     gccctgcttg ccgccatcgt tcgccgagat cccgaagcag ctagagaagc ctctaatgaa       660
     cacttaagtt acattgagga agtcatgctg tctgttaggg aagaagatag ccggttgcag       720
     cgtagtctgc gccgtttaaa aagcggtgtg taa                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page