(data stored in ACNUC7421 zone)

EMBL: CP000821.PE431

CP000821.PE431       Location/Qualifiers
FT   CDS_pept        523795..526461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0431"
FT                   /product="Pyruvate dehydrogenase (acetyl-transferring)"
FT                   /EC_number="1.2.4.1"
FT                   /note="KEGG: slo:Shew_3431 2-oxo-acid dehydrogenase E1
FT                   subunit, homodimeric type"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35044"
FT                   /db_xref="GOA:A8FQC1"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQC1"
FT                   /protein_id="ABV35044.1"
FT                   /translation="MSEHMLQDLDPLETQEWVDSLQAVLEQEGPERAHYLLEKLIDKAR
FT                   RNGTHLPYKATTAYLNTIPAGQEPHVPGNQEMERRIRAIVRWNALAMVLRGSKKDLELG
FT                   GHISSFASSATIYDVCFNHFFRGPNEKDGGDLVYFQGHIAPGIYSRSFLEGRLTEDQMN
FT                   SFRQEVDGKGLPSYPHPKLMPDYWQFPTVSMGLGPIQAIYQARFLKYLTDRGLKDCSEQ
FT                   TVYCFLGDGECDEPETLGAIGLAAREELDNLVFIVNCNLQRLDGPVRGNGKIIQELEGE
FT                   FRGAGWEAVKVIWGRYWDPLLARDTSGKLLQLMEETVDGEYQNCKAKGGAYTREHFFGK
FT                   YPETAEMVANMSDDDIWRLNRGGHDPVKIFAALQHAKDTKGRPTVILAKTVKGYGMGDA
FT                   GEGKNIAHNVKKMGVESLKYFRDRFNIPISDDQLEDIPFYHPGADSEEVKYLKARRAEL
FT                   HGAMPARREKFSEELEVPSLKIFDSVLKGSNGREISSTMAFVRILTALLKDKKIGKQIV
FT                   PIIPDEARTFGMEGLFRQVGIYAHEGQKYVPQDSDQVAYYREDKSGQVLQEGINELGAM
FT                   SSWVAAATSYSVNDTPMIPFYIYYSMFGFQRIGDMAWAAGDMRARGFMVGGTSGRTTLN
FT                   GEGLQHQDGHSHVLANTIPSCVSYDPTYGYEIAVVVQDGIRRMYGEQQEDIFYYLTTMN
FT                   ENYEQPAMPEGAEEGIVKGIYKLETVEGSGKGKVQLMGCGTILEQVRKAAQALAKDFGI
FT                   SADVFSVTSFNELTRDGQAAERYNMLHPTETPQEAYISQVISSESPAIVATDYMKIYGE
FT                   QLRAYIPTDYKVLGTDGFGRSDSRENLRHHFEVDAKFIVIASLKSLVDRNELPVDVLTK
FT                   AISEYGIDVDKINPQYA"
     atgtctgaac atatgctaca agacttagat ccattagaga cccaagagtg ggtcgattct        60
     ctgcaggcag tactcgagca agagggtcct gaacgcgcac attaccttct tgaaaagctt       120
     atcgacaaag cacgtcgtaa tggtacacat ctgccttata aagcgactac agcttatttg       180
     aatacgattc cggctggcca agagcctcat gtgcctggca accaggagat ggagcgtcga       240
     attcgcgcca tcgttcgttg gaatgcattg gctatggttc ttcgtggttc taagaaagat       300
     cttgaactag gtggccatat ctctagtttc gcttcaagcg ccacgatata cgatgtctgc       360
     ttcaaccact tcttccgcgg tccaaatgaa aaagatggcg gcgatctagt ttacttccaa       420
     ggccatattg ctcccggtat ttattcacgt tctttccttg aaggacgttt gactgaagat       480
     cagatgaaca gcttccgtca agaagtcgat ggtaaaggtc tgccttcata cccacatcct       540
     aagttaatgc ctgactactg gcagttccca acggtatcta tgggtctggg tcctatccag       600
     gctatctatc aagctcgttt ccttaagtac cttaccgacc gtggtcttaa agattgttca       660
     gagcaaaccg tttactgttt ccttggtgac ggtgagtgtg atgagccaga gactctaggt       720
     gctatcggtc ttgctgcgcg tgaagagctg gataacttag tcttcatcgt taactgtaat       780
     ctacagcgtc ttgacggccc tgtacgtggt aacggcaaaa tcattcaaga gcttgaaggc       840
     gaattccgtg gcgcaggctg ggaagcggtt aaagtgatct ggggtcgtta ctgggatcca       900
     ttattggctc gtgacaccag cggtaaacta ctgcagttga tggaagagac ggtcgatggt       960
     gaataccaga actgtaaggc caaaggcggt gcatatactc gtgagcattt cttcggtaaa      1020
     tacccggaaa ctgccgagat ggttgctaac atgtcagacg atgacatctg gcgcctgaac      1080
     cgtggtggcc acgatcctgt taagattttt gctgcgcttc agcatgctaa agacactaaa      1140
     ggtcgtccaa cagttattct tgctaaaacc gtaaaaggtt acggtatggg tgacgcgggt      1200
     gaaggtaaaa acatcgctca caacgtgaag aagatgggtg ttgaatcact taagtacttc      1260
     cgcgatcgtt tcaatatccc gatctcagat gatcagttag aagatattcc tttctaccac      1320
     ccaggtgcag actcggaaga ggttaaatac ctcaaggcgc gtcgtgctga actacatggt      1380
     gccatgcctg cacgtcgtga gaagttctct gaagagcttg aagtaccatc attgaagatt      1440
     ttcgattcgg tactgaaagg ttcaaatggc cgtgagatct caagcacaat ggcattcgtg      1500
     cgtattttga ctgcactgct aaaagacaag aagattggta agcaaattgt accgattata      1560
     cctgacgaag cccgtacctt tggtatggaa ggcctattcc gccaagtggg tatttacgct      1620
     cacgaaggtc aaaagtatgt cccacaagat tcagatcaag tggcttacta ccgcgaagac      1680
     aagagcggtc aagtattgca agaaggtatt aacgagctag gtgcaatgtc atcttgggtc      1740
     gcagcggcaa ccagttactc tgttaacgac acgccaatga tcccgttcta tatctactat      1800
     tcaatgtttg gcttccaacg tatcggcgac atggcttggg ctgcaggtga tatgcgtgcg      1860
     cgtggcttca tggtcggtgg aacatcgggt cgtacaacct tgaatggtga aggtctacag      1920
     catcaggatg gtcacagtca tgtattggct aatactattc caagctgcgt ctcttatgat      1980
     cccacttacg gatatgagat cgctgtcgtg gttcaggatg gtattcgtcg catgtatggt      2040
     gagcagcaag aagatatctt ctactactta accactatga acgaaaacta cgaacaacca      2100
     gctatgccag agggtgccga agagggtatc gtcaaaggta tctataagct ggagaccgtt      2160
     gaaggttcgg gtaaaggtaa agttcagtta atgggttgtg gcaccattct tgagcaagta      2220
     cgtaaagcgg ctcaggcttt ggctaaagac ttcggtatct ctgcagatgt attcagtgtg      2280
     accagtttca acgagttaac tcgtgatggt caggctgcag agcgttataa catgttacat      2340
     ccaacggaaa cgccacaaga ggcttacatc agtcaagtca tctccagtga gtctccagcc      2400
     atcgtcgcta ccgattatat gaagatatac ggcgagcagc ttcgcgcgta catacctaca      2460
     gattataaag tgttaggtac cgatggtttc ggtcgtagcg atagccgtga aaacttacgt      2520
     caccactttg aggttgatgc gaaatttatc gtgattgcat cacttaagtc acttgttgac      2580
     cgtaatgaac tgcctgttga tgtgctaaca aaagccatta gcgagtacgg tatcgatgtt      2640
     gacaagatca acccgcagta cgcgtaa                                          2667
//

If you have problems or comments...

PBIL Back to PBIL home page