(data stored in ACNUC7421 zone)

EMBL: CP000821.PE432

CP000821.PE432       Location/Qualifiers
FT   CDS_pept        526474..528111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0432"
FT                   /product="Dihydrolipoyllysine-residue succinyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /note="KEGG: slo:Shew_3430 pyruvate dehydrogenase complex
FT                   dihydrolipoamide acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35045"
FT                   /db_xref="GOA:A8FQC2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQC2"
FT                   /protein_id="ABV35045.1"
FT                   /translation="MSELKEVLVPDIGGDDVQVIEICVAVGDQLAAEESIITVESDKAT
FT                   MDIPAPFAGTLAELKIAVGDTVSEGTLIAMMSAQGASTEVTAATAAPEPTPVAPAAPVD
FT                   AAPVPASTATQVIEVKVPDIGDAADVEIIEVLVAVGDSIDVDTGLITLETDKATMEVPA
FT                   PSAGVVKELKVAVGDKVSEGSLVLMLEVGASAPAAIVAPVEAPVVAPVAQPAQAATSKP
FT                   PVPHHPSAGSKPVTGAVHASPAVRRLAREFGADMTLVKGTGRKGRILKEDVQAFIKYEL
FT                   SRPKASAATAVAGGAGGLNVIAAPKVDFAKFGEIEEVPLTRIQKISGPNLHRNWVTIPH
FT                   VTQFDEADITEMEAFRKQQNELAAKRKTGIKITPLVFMMKAVAKTLQAFPVFNASLSAD
FT                   GESLIKKKYYHIGVAVDTPNGLVVPVVRDVDKKGIHELTQELTEISIKARDGKLKSADM
FT                   QGSCFTISSLGGIGGTAFTPIVNYPDVAILGVSKSEIKPKWNGKDFEPKLMLPLSLSYD
FT                   HRVIDGAMAARFSVTLSSMLSDIRTLIL"
     atgtctgaat taaaagaagt tttagtcccc gatatcggtg gtgacgatgt acaggtaatt        60
     gagatctgtg ttgctgttgg tgatcaactt gcagccgaag agtcaattat taccgtagaa       120
     agtgacaagg cgaccatgga cattccagcg ccttttgccg gcacgttagc cgagcttaaa       180
     atagccgtcg gtgacaccgt ctctgaaggc accttgattg ctatgatgtc tgcgcaaggt       240
     gcaagcactg aagttactgc ggcaacagcg gctccagagc cgactccggt tgcgccagca       300
     gcacctgttg atgcagctcc tgttccggct tctactgcta cacaagttat tgaagtcaag       360
     gtgcccgata ttggtgatgc ggccgatgtc gaaatcatcg aagtgctggt ggccgtgggt       420
     gacagcatag atgtcgatac cgggttgatc accctggaaa ccgataaagc cacgatggag       480
     gtgcctgcac cttcagccgg tgtggtgaaa gagttaaaag tagccgttgg tgataaagtt       540
     tctgaaggtt cgcttgtgct tatgttggaa gttggtgctt cagcaccagc agcgatagtg       600
     gctccggttg aagccccagt tgtagctcct gtagctcaac cagctcaggc cgcgacaagc       660
     aagcctccgg ttccgcatca tccaagtgca ggcagtaagc ctgtcaccgg agcggtacac       720
     gcttcaccag ccgttcgtcg tctggctcgt gagttcggcg cagatatgac cttagttaaa       780
     ggtacgggcc gcaaaggtcg tatccttaag gaagacgttc aggcgttcat taaatatgag       840
     cttagccgtc ctaaggcatc tgcagcgaca gccgttgctg gtggtgcggg tggactcaat       900
     gttattgctg cacctaaagt cgattttgct aagtttggtg aaatcgagga agtgccccta       960
     acacgtattc agaagatctc tggtccgaac ctgcatcgta actgggtcac cattccgcat      1020
     gtgacgcaat tcgacgaagc cgatatcacc gagatggaag cattccgtaa gcagcaaaat      1080
     gaacttgcag ctaagcgtaa gacaggtatt aagatcacgc cgcttgtctt tatgatgaaa      1140
     gccgttgcca agaccctaca ggctttccct gtgtttaatg ccagcctaag tgccgatggt      1200
     gagtctttaa ttaagaagaa gtattaccat ataggtgttg cggttgatac gccaaacggc      1260
     ctagtggttc cggttgttcg tgatgttgat aagaaaggta ttcacgaact gactcaagag      1320
     ttgactgaga tctcgattaa agcacgtgat ggtaagctta agtctgcaga tatgcagggc      1380
     agttgtttca ctatctcgag tctgggtggt atcggtggta cggcatttac gcctatcgtc      1440
     aattacccgg atgtggctat tttaggtgta tctaagtcag agattaaacc aaagtggaat      1500
     ggtaaagatt ttgagcctaa gctaatgttg ccgctatctc tctcttatga tcacagggtg      1560
     atcgacgggg cgatggcagc gcgctttagc gtgacactgt caagtatgct gtccgacata      1620
     cggacgctta ttttgtaa                                                    1638
//

If you have problems or comments...

PBIL Back to PBIL home page