(data stored in ACNUC7421 zone)

EMBL: CP000821.PE436

CP000821.PE436       Location/Qualifiers
FT   CDS_pept        536775..538829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0436"
FT                   /product="Endothelin-converting enzyme 1"
FT                   /EC_number="3.4.24.71"
FT                   /note="KEGG: slo:Shew_3426 endothelin-converting enzyme 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35049"
FT                   /db_xref="GOA:A8FQC6"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQC6"
FT                   /protein_id="ABV35049.1"
FT                   /translation="MNRVSKLAIGIALSLGLAACSSNEPTTTVAEEVTKVSGVEQENFD
FT                   NAVRHQDDFYYSVNGHWLANTPIPADKSNYGAFSVLYEQSQNALKKIIDEAAAKQDKVA
FT                   GSSEQKVGDFYASYMNTDVIEKLGISPLSDLLSDISSAKTHKDIAGLMGSLLNSGVQMP
FT                   FGFYVNNDAKNSSQYAVYLYQSGLTLPDRDYYLKDDEKFVANRAALNAYVADIMAQAGS
FT                   QDAERVAASVAKIEHFIAQSQWSRVESRDANKSYNMMDSAELQATVSSFDFAQFAANAN
FT                   MSSVKEAVVRQPSYFEKFGAQFNEFTVSEWQDYLSFHLVDSYGELLSKNFVDLHFAFHS
FT                   KTLMGIEAQKPRWKKAVDAADQVIGELVGKEYVKQHFKPEAKEKMEELIQNLIKGFEVS
FT                   INELEWMTPETKIAAQEKLSKFTYKIGYPDKWKDYTDLSIKADQLVGNIQRYSKFEYKT
FT                   MLNKLGKPIDRTEWHMTPQTVNAYYSPVMNEIVFPAAILQPPFFNMDADDAINYGGIGA
FT                   VIGHEISHGFDDQGAKYDGDGNLRDWWTDKDREEFQKRGAQLSAQYSSYEALPGKHVNG
FT                   DLTLGENIGDLGGLTVAARSYHLSLNGKESPVIEGLTGEQRLFIGWSQVWRRNYRDEEL
FT                   GRRLMTDSHSPSHFRAMGTPRNIPAFYQAFDLKEGDKMFLSPEDRVKIW"
     atgaacagag taagtaaact ggcaattggt attgcactta gcttaggtct tgctgcttgt        60
     agcagtaatg aaccaacgac aacagtcgct gaggaagtga ctaaggtgtc gggagtcgaa       120
     caagagaact tcgataatgc ggttcgccat caagatgatt tttactacag cgtaaatggt       180
     cattggctag ctaacactcc aattcctgca gataagtcta actacggcgc attttcagta       240
     ctttatgagc agagtcaaaa tgcactgaaa aaaattatcg atgaagcggc ggctaagcaa       300
     gataaagttg caggctcgag tgagcaaaaa gtgggtgact tctatgccag ctatatgaat       360
     actgatgtca tcgagaagct aggtatcagc ccgttaagcg acctgctgtc cgatatctct       420
     tcggcaaaga ctcacaaaga tatcgccggc ttgatgggga gtctgctaaa tagtggtgta       480
     cagatgccat tcggttttta cgttaacaac gacgctaaaa actcaagcca gtatgcggtc       540
     tacctctacc agtcaggctt gactctaccc gatcgtgatt attacctgaa agatgatgaa       600
     aaatttgtag ccaacagagc cgcactgaat gcctatgttg cggatattat ggcgcaagcc       660
     ggcagtcaag atgctgagcg agtggcagcc agcgtagcta agattgagca ctttatcgca       720
     cagagccagt ggagccgtgt ggagtcgcgt gatgcgaata agagctacaa catgatggac       780
     agcgccgagc tacaggctac agtgagttct tttgactttg ctcaatttgc cgctaacgcc       840
     aatatgagtt cggtcaaaga agctgtggtg cgtcaacctt cttattttga aaaatttggt       900
     gctcagttca atgagtttac tgtgagcgag tggcaggatt acctctcttt ccatcttgtt       960
     gatagttacg gggagttgtt gagcaagaac tttgtcgatc ttcattttgc tttccatagc      1020
     aaaaccttga tgggaattga agcgcagaag ccacgctgga agaaggcagt cgatgccgcg      1080
     gatcaggtca ttggtgagct tgtgggtaag gagtatgtga aacaacactt caagccagag      1140
     gcaaaagaga agatggaaga gctcattcaa aatctcatta aaggttttga agtcagtatc      1200
     aatgaactcg aatggatgac tccggagact aagattgcgg ctcaagaaaa gttgtctaag      1260
     tttacctata agattggata tcctgacaaa tggaaggatt acaccgacct aagtattaaa      1320
     gcagatcagc ttgtggggaa tattcagcgc tattctaaat tcgaatataa aaccatgctg      1380
     aataaactag gtaagcctat cgatcgcact gagtggcata tgacgccaca aacagtaaat      1440
     gcttactaca gcccggtgat gaacgaaatc gtgttccctg ccgcgatcct tcagcctccc      1500
     ttctttaata tggatgccga tgatgcgata aactacggtg gtattggtgc ggttatcggt      1560
     catgagatca gccatggttt cgatgatcaa ggggccaagt atgacggcga tggtaacctg      1620
     cgcgattggt ggacggataa agaccgtgaa gagttccaga agcgtggggc gcaactgtct      1680
     gctcagtact catcttatga agcgctacct ggcaaacatg tcaatggcga tctgacccta      1740
     ggtgagaata tcggtgactt aggtggtctg actgttgctg ctcgctcata tcatttgagc      1800
     ctgaacggta aagaatcgcc tgtcattgaa ggtttaaccg gtgaacagcg tctgtttatc      1860
     ggttggtcgc aagtatggcg tcgtaattat cgtgatgaag agctgggccg tcgtctgatg      1920
     accgactctc attcaccgag tcacttccgc gccatgggca cgccaagaaa catccctgcc      1980
     ttctatcaag cattcgattt gaaagagggt gataagatgt tcctgagccc tgaagatcgc      2040
     gttaagatct ggtaa                                                       2055
//

If you have problems or comments...

PBIL Back to PBIL home page