(data stored in ACNUC7421 zone)

EMBL: CP000821.PE44

CP000821.PE44        Location/Qualifiers
FT   CDS_pept        50517..50795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vpa:VP3032 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34657"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP84"
FT                   /protein_id="ABV34657.1"
FT                   /translation="MNQNILFPDLQDWDEKTQSVVFPAQVQGANIECRIGLSKLSEMAL
FT                   TLLKSTDSDIKEKALNLFEEYRFDIEEEVETLIELESFDEQGRLVVK"
     atgaatcaga atattttgtt tcccgatctg caagattggg atgagaaaac gcaatcagtg        60
     gtatttccgg ctcaggtaca aggtgcgaat attgaatgtc gtatagggtt gtctaagcta       120
     tccgaaatgg cattaacgct cttaaaaagt accgacagcg atatcaaaga gaaagcatta       180
     aacttgtttg aagaatatag gttcgatatt gaagaggagg ttgaaacact catcgaattg       240
     gagtcattcg atgagcaggg tcggcttgta gtaaagtaa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page