(data stored in ACNUC7421 zone)

EMBL: CP000821.PE441

CP000821.PE441       Location/Qualifiers
FT   CDS_pept        545598..548210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0441"
FT                   /product="sensory box protein"
FT                   /note="KEGG: son:SO0437 sensory box protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35054"
FT                   /db_xref="GOA:A8FQD1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQD1"
FT                   /protein_id="ABV35054.1"
FT                   /translation="MRIGKKLIVFIVGFCLPAVISVSYCLSMWFDHRVDTFKNSAVNIE
FT                   LSTIKTQIEKDINQLQLLANVYALPLSKLAIEERKLLDEAWRDSQLAEHLSLFYLNNGE
FT                   LQPFSPIYDDIMSFEFDTVPVQLKHATQPLSGIYMLQDKSFIVSLVPVSQSRSIILARQ
FT                   LTPEYLSSYGLKGLVSHINLVPGESSLVYDVNSDKPISSIKVPSLVFESPVHLEIQFAE
FT                   NAFNQVKLKYDLVTFSIVGVGLLILIIGYIWLKLGLIRPFRRLMTQVADIDPIAKTYTP
FT                   LVGSGCSELVIMAERVNTLLARIFQQKERFKTTLESIAEAVILTDIGAKVVYLNPQAER
FT                   LLGVKGESAIGVSVDSLVKTDKSIKDDLFEFMFSQAQQPVLSKLKLKTDKTRILERSIS
FT                   NLLNQQRIVIGTVIVLRDITREELLKRQLRQKANFDSITSLLNRRAFEERLEKFSHDAQ
FT                   SIAICYFDLEQFKLINDSCGHSAGDTMLAMVAKAMQSCLSKDEMLARLGGDEFGLAIRD
FT                   HNASEVAQLVKRIVSSVSMQVLRDNGCHYKVGVSAGVAIARAPYISPKELIKDADVACI
FT                   AAKRKGSNQVHFYDDNDKESIYQRNAPMWAVRIGQAIEHNELLLYYQPIKGMGPGEHKQ
FT                   RMEILLRIQEPCGRILSPAQFIEAAERFKLMNDVDKEVIRKAFLWLSLHEEIWDDHCIS
FT                   INLSGNSLGAEGMVEYIAEQFKRFEIPSKCICFEITETSAIQNRNRAMDMLNYLRKLGF
FT                   SFALDDFGTGFASYGYLKELPVDYVKIDGCFVKSLATNAKDFAIVKSIHDVCDVMGIET
FT                   VAEFVENQDIIDRLEDIGINYAQGYAIGRPKPLETYIELRRSRGQPLQAKPALELISA"
     atgcgtatag ggaaaaagtt aatcgtcttt attgtaggtt tctgccttcc cgcggtgatt        60
     tctgtctctt attgtttaag catgtggttc gatcatagag ttgatacatt caaaaacagt       120
     gcggtcaaca ttgaactcag caccattaag acccagatag aaaaagatat aaatcagctg       180
     cagctattag ctaatgtcta cgccttaccc ctttcaaaac ttgccatcga agagagaaaa       240
     ttattagatg aagcttggcg tgacagtcag cttgccgagc atttgagtct gttttatctg       300
     aataatggtg aactgcagcc attctccccc atatacgatg acatcatgtc atttgagttc       360
     gatacggtgc ctgtccagct caaacatgcc actcaacccc tgtccggtat ctatatgctg       420
     caggataaga gtttcatcgt cagcttagtg ccagtttcgc agagtcgttc gattatattg       480
     gccagacagc ttacacccga atatctctct agttatggcc tcaaagggtt agtcagtcat       540
     atcaatttgg tgccaggtga atcaagtctg gtctatgacg taaatagtga taaaccaata       600
     tcgagtatca aggtaccaag tttagtcttt gaaagtcctg ttcatctgga aattcagttc       660
     gccgaaaatg cgttcaatca ggtgaagtta aagtatgacc tggtgacctt ctctatcgtg       720
     ggggtgggat tactgatact tatcatcgga tatatctggc tcaagctggg gcttattcgt       780
     cccttccgtc gactgatgac tcaggttgcc gatatcgatc ccattgccaa aacctacacg       840
     ccgcttgtcg gaagtggttg ctcagaactt gttatcatgg ccgagagagt gaataccttg       900
     cttgcacgaa tatttcagca gaaggagcgc tttaaaacga cattagaatc gattgccgag       960
     gcggtgattc tgaccgatat cggagctaag gtggtgtatt taaatcccca ggccgagcgg      1020
     ttactcggcg ttaaagggga aagtgccata ggcgtttcag tagactcctt ggtaaaaaca      1080
     gacaagagta tcaaagatga cctgtttgaa ttcatgttta gtcaggctca acaacccgta      1140
     ttaagtaaac taaagctgaa aaccgataag actcgaattc tggagcgtag tatcagtaat      1200
     ttacttaatc agcagcggat cgtgataggt actgtgattg tgcttcgcga tattacccga      1260
     gaggagctac ttaaaaggca gttaaggcaa aaggctaact tcgactccat cacttcacta      1320
     ttaaatcgtc gcgcctttga agagaggttg gagaaattta gccatgatgc tcaatcgata      1380
     gcgatctgct atttcgacct ggagcagttc aagttaatca atgactcctg cgggcacagc      1440
     gccggagata ccatgctggc catggtagca aaagcgatgc aatcctgttt gagtaaagat      1500
     gagatgttag ctcggttagg tggagacgag ttcggtttag ctatccggga tcataatgca      1560
     tcagaggtgg ctcagctggt gaaacggatc gtttccagtg tttcgatgca ggtgctacgt      1620
     gataatgggt gccactataa ggtcggggtc agtgccggtg tggctatcgc tcgggcaccc      1680
     tatatcagcc cgaaagagct gatcaaagat gccgatgtgg cgtgtattgc cgctaagcga      1740
     aaaggcagta atcaagttca tttttacgat gataacgata aagaatccat ctatcagcgt      1800
     aacgcaccta tgtgggcggt aagaattggt caggcgatag agcataatga actactactc      1860
     tattaccagc caatcaaagg tatgggcccg ggcgaacata aacaacgcat ggagatctta      1920
     cttcgcattc aggaaccatg cgggcgcatc ttatctccgg cccagtttat tgaagccgct      1980
     gagcggttta agctaatgaa tgatgtcgat aaagaggtca ttcgaaaggc atttctgtgg      2040
     ttgtcgctgc atgaagaaat ttgggatgat cactgcatct cgattaacct ttccggcaat      2100
     agcttaggtg ccgaaggcat ggtggagtac attgccgagc agtttaagcg cttcgagatc      2160
     ccgagcaaat gtatctgttt tgagatcaca gagaccagcg cgattcaaaa cagaaatcga      2220
     gccatggata tgctcaatta cctgcgtaaa ctaggttttt catttgcctt agatgatttc      2280
     ggtaccggtt tcgcatcgta tggctacctg aaagagcttc ctgtcgacta cgtaaaaatt      2340
     gatggctgtt ttgtcaaaag tttagcgacc aatgcgaaag actttgccat cgttaagtcc      2400
     attcacgatg tctgtgatgt gatgggaatt gagactgtgg cagagtttgt tgaaaatcag      2460
     gatattatcg acaggcttga agatatcggc attaactatg cccaaggcta tgcaataggc      2520
     cgccctaagc ctttagagac atatattgag cttagacgtt ccagagggca gccgttgcaa      2580
     gctaagcccg cactggagct tatcagtgcc tga                                   2613
//

If you have problems or comments...

PBIL Back to PBIL home page