(data stored in ACNUC7421 zone)

EMBL: CP000821.PE442

CP000821.PE442       Location/Qualifiers
FT   CDS_pept        complement(548378..551380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35055"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQD2"
FT                   /protein_id="ABV35055.1"
FT                   /translation="MRYLLLMITFLITACGGGGDDDTTTPTQEKLTHPGLSALDIRVDY
FT                   SPDGSLTPVLSGSQGNISFSLADGAANDVVRVNQNSLTILNVGQTKLIVTDSGNSQYKA
FT                   TSRSLNVSVDRASRDPLLTNNYSYPYAAGAIHQVGVSGAKGQLLYELSTGYPDDVVKID
FT                   IAGSLIVWGEGQTQVTVKDDGGRNYQASESQFSITVEAANSQFASYRDITNKPLVFGGT
FT                   LLPVYSGSPTSEISYAIAENASQDVVQIHPITGVMNIKGAGETEIVVSQTAEDNHQDIA
FT                   KQTFKVRINKADNTDFIANDLTLPYGFDDEPRLQTIGAQGTLTFEIVDGESTDVINFIN
FT                   SETGQYRFSGIGETKVKITDSGNRNYLSKTVITTVNVERVQSVPLSSVNLESAYQQNKV
FT                   ISAQVASRQGKLSFSLAKDSATDVVSIDALSGEMTVLKPGKAEITVTDDGDLFYIPQTT
FT                   SFFVTINKLVNDQFSVDDDLYDNVANTVYTPVAKGSQGPVTYAISANSTANVLSQDPTT
FT                   KVITLTGAGRGWITATDHGNDYYQSQTTDFIVDVGYADGTLKPLAISAGYAPNKVVTIP
FT                   VSGVVGQLSSQLERGQPDDVVNIDIVNRTVTIKNAGTTYYTLTDSGSAAIAPRRVQLRV
FT                   TIAKAAANVDLSLTSTLIDTIYEEGKQLSSPAVSGSATESTIKYYVDYSDRQVVTADSS
FT                   SGALTIKGAGSAQVQVTEVSRNFEDTTRSFTVNVGKAKHPGLTVAKQVPGASYYPGLEM
FT                   APAELGNQFGELSFKFTHTEKPETYELTRNGTLRVLKYAASRTNTSVRITVTDDGGDDY
FT                   LPSSVDYDVYVNPIEEGTGEKSVFTFDGTELSITSPIDVAAGDVTYFSASDTRSEAETM
FT                   GDNLQKSGGYATQRVTVCHDPSVLTTCTLVTVRLQNTSHCPDGSKIAYPVGAKIRYECP
FT                   GLKQPINSEVMVSFDKTDLFNPSLAVGTYQALEPITLVHFAKPYRAGGVIEMGDIQARA
FT                   WWLIKVNLTVN"
     atgagatacc tgttattaat gatcaccttc ctgatcaccg catgcggtgg cggcggtgat        60
     gatgacacca cgacaccgac acaagagaaa ctaactcatc cggggctttc agcacttgat       120
     atccgggtcg actattcacc cgatggtagc ctgacaccag tactcagtgg ttctcagggc       180
     aatataagtt tcagcctggc cgacggcgct gcgaatgacg tagtgcgagt caatcaaaac       240
     agcctaacta tattaaatgt cggtcaaacc aagttaatcg ttaccgatag tggtaatagc       300
     cagtataaag ccacaagcag atcactaaat gtttctgtcg acagagcgag tcgtgatcct       360
     ctgctgacta ataactactc ctacccttat gctgccggtg cgattcacca ggtcggcgtt       420
     agtggtgcaa aaggtcaatt gctttacgag ctcagcactg gttatcccga tgatgttgtc       480
     aaaatcgaca tcgcaggttc gctaattgtt tggggcgagg ggcagactca agttaccgtc       540
     aaagatgacg gggggcgaaa ctaccaggcc agcgagagtc aattctccat taccgtcgaa       600
     gccgcaaact cgcagtttgc ttcctatcga gacatcacca ataaaccact ggtttttggt       660
     ggcaccttgc ttccggttta ttcaggatca ccgacaagtg agataagcta cgctatcgca       720
     gagaatgcca gtcaagatgt agttcagatc cacccaataa cgggtgtgat gaatatcaaa       780
     ggagccggag agacagaaat cgtcgtcagt cagacagctg aagataatca tcaagatatt       840
     gccaagcaaa cttttaaagt cagaattaac aaagccgata acacagattt tatcgccaat       900
     gatctaacgc tcccctatgg attcgatgat gagccaagac tgcaaacaat cggcgctcag       960
     ggaaccctca ctttcgagat tgtcgatggc gagtcaaccg atgtgatcaa ctttatcaac      1020
     agcgaaaccg gacaataccg cttcagcggt atcggtgaga cgaaggtgaa gataacagac      1080
     tcaggaaaca gaaactatct gagtaaaacg gttattacca cagtgaatgt cgaacgtgtt      1140
     caatcggtac cgctctcctc tgtcaatctt gagagtgcat accagcaaaa caaggtgata      1200
     tcggctcaag tcgcaagcag gcagggcaag ctaagcttct ctcttgcaaa agatagcgcg      1260
     acggatgtgg taagcattga tgcactatcg ggtgagatga cggtactgaa acccggtaag      1320
     gcagagatca cagtcaccga tgacggtgat ctgttctaca taccgcaaac taccagcttc      1380
     ttcgtgacca tcaataaact cgttaacgat caattcagtg tcgacgatga tctgtacgat      1440
     aatgtggcca ataccgttta tacaccggta gcgaaaggaa gtcaggggcc tgtcacctac      1500
     gcgatttctg ccaactcaac ggctaacgtg ttaagccaag atccgacgac caaggtcatc      1560
     acattaaccg gtgccggtcg gggttggata accgcaaccg atcatggcaa cgactactac      1620
     cagagccaaa caactgactt cattgtcgat gtaggctatg ccgatggtac cttgaaaccc      1680
     ttagccattt cggcaggcta tgccccaaac aaggtcgtca ctattccggt atcgggtgtc      1740
     gttggacaac taagctctca gctcgagaga ggccaacctg acgatgtcgt caatatcgat      1800
     attgttaacc gcaccgtcac tattaaaaat gctggcacca cttactacac gcttactgat      1860
     tcaggaagtg cggcaatcgc ccctcgtaga gtgcaattac gggtaacgat agccaaggcc      1920
     gcagcgaatg ttgatttgag cctgacttca acactcatag atacgatata tgaagagggt      1980
     aagcagctta gttcacccgc tgtatcgggt agcgcgacag agagtacgat taaatactat      2040
     gtcgattata gcgatcgaca ggtagtgact gcagactcaa gtagcggtgc gctaacaatt      2100
     aaaggagccg gttcggctca ggtacaggta actgaggtga gccgcaactt tgaggacacg      2160
     acacgcagct tcacggttaa cgtcggtaag gctaagcatc ctggattgac cgttgctaaa      2220
     caggttcccg gcgcgagtta ttacccgggg cttgagatgg cgcccgcaga gcttggcaat      2280
     caattcggag agcttagctt caaattcaca cacacagaaa agcctgagac ttatgaatta      2340
     acccgaaacg gcaccttgag ggtactcaag tacgcagcct cgcgtactaa cacttctgtc      2400
     cgtataaccg tcaccgatga cggcggcgat gattacctgc caagctctgt cgattatgat      2460
     gtttatgtca atcctatcga agagggaact ggtgaaaagt ctgtatttac gttcgacggc      2520
     accgagctat cgataacttc gcccatcgat gtggctgccg gagatgttac atacttctcg      2580
     gcctccgata cccgttcaga agcagaaacc atgggtgata atcttcaaaa atccggcggt      2640
     tatgccacac agagggttac cgtttgtcat gacccatcag tcttaaccac ttgcacctta      2700
     gtaaccgtca gactgcaaaa caccagccac tgtcccgatg gcagtaaaat agcctatcct      2760
     gtaggcgcta aaattcgtta tgagtgcccg ggcctaaaac aaccgataaa ctctgaggtg      2820
     atggtaagct tcgataaaac ggatctcttt aatccatcgc tggcagttgg cacctatcag      2880
     gctctagaac cgataacctt agtacacttt gccaaaccct atcgcgcggg tggtgtcatc      2940
     gagatgggtg atattcaagc cagagcctgg tggctgatca aggtaaatct gaccgtaaac      3000
     taa                                                                    3003
//

If you have problems or comments...

PBIL Back to PBIL home page