(data stored in ACNUC7421 zone)

EMBL: CP000821.PE447

CP000821.PE447       Location/Qualifiers
FT   CDS_pept        557633..559471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: saz:Sama_2990 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35060"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQD7"
FT                   /protein_id="ABV35060.1"
FT                   /translation="MKVLNKRYLALVVAGAMGLSACGSDGKDGEDGTTPPPPTVGGSQV
FT                   TNVEMLSHTLEEGLVRFEFEITNEEGVLITGLEEASAEVAALTEKGIQRSRDGSVGGSA
FT                   NVSTEGASLTMTQDGRYEFIAPMAAVNAGTEGLIRLAVGGGDNIAKSRYIVVDKTENIH
FT                   TTSTATCQSCHVDFLASSIKHSSYTAINAEGETDLVAGCMACHNHVPRDVDDSGSSLNT
FT                   GGYAKNSLQKIGHINHQKFEKDFAPSNCYTCHAEPIETVYSQQTCIDCHDTANVETSNL
FT                   AATFNSFNEGSDMRLFHKKIAEKKAVHEEHSLATSQVYNNELGEFCTDISLFKGEEQLD
FT                   LEGLTSDGTISYIGAYLHGYENASIVGRAARSYSATFDAAGSATLCFSSLDELFPEIIA
FT                   SSRVTFNFGEDAGYDGVTLHGYSDALSGTEYARRHSVTADSCTTCHTNGSNYHKNGSYN
FT                   DGGLGCVACHNNGQDRNAKSSAPGFGPMVHSMHWGVGNTATDPDGEANSAAKLNAENCV
FT                   ACHAEGIDIDAIPNQYILSKAYNGGESGVMTSPVTANCFACHNDDSAKNHMLQQGGEIN
FT                   VEKLEDWYTLPTSESCSTCHAEGKSYGIEKFHVFER"
     atgaaagtac tgaataagcg ttatctggct ttggtagtgg ctggagcgat gggcttaagt        60
     gcctgtggaa gtgatggtaa agatggcgaa gatggcacta cgccgccacc gccaacggta       120
     gggggctctc aagtcaccaa tgttgagatg ctgtctcaca ccttggaaga gggactggtg       180
     cgatttgagt ttgagatcac caatgaagag ggagtcttaa tcaccgggct cgaggaagcc       240
     agcgcggaag tggcggcact aaccgagaaa ggtatccagc gtagccgtga tggctctgtg       300
     ggtggcagtg ccaatgtctc taccgaaggt gccagcctca ccatgactca agatggtcgc       360
     tatgagttta tcgcgcccat ggctgcggta aatgcgggta ccgaaggact tattcgttta       420
     gccgttggcg gtggcgataa tatcgctaag tctcgttata ttgtggtcga taaaactgaa       480
     aatattcata cgacatcgac ggcgacctgt cagagctgcc acgtggactt cttagcctcc       540
     tcaattaagc attcgagtta tacggcaata aatgctgaag gcgaaactga cttggttgcc       600
     gggtgtatgg catgtcataa ccacgtcccg cgcgatgtgg atgatagtgg tagttcattg       660
     aataccggcg gttatgctaa gaatagcctg cagaagattg gtcatatcaa tcatcagaag       720
     tttgagaagg attttgctcc ctctaactgt tacacctgtc acgcagagcc tatagagact       780
     gtctattcac agcagacatg tattgattgt catgatactg cgaatgttga aacttcaaat       840
     ttagcggcga ccttcaattc cttcaatgaa ggtagtgata tgcgcttgtt ccataagaag       900
     atagccgaaa agaaagcggt tcatgaagag catagcttgg ccacatctca ggtttacaat       960
     aatgagttag gtgagttctg taccgatatc tctctgttca agggggagga gcagttagat      1020
     ctggagggct taacatcgga cggtaccatc tcttatatcg gggcttatct gcacggctac      1080
     gagaatgcgt ctattgttgg tcgcgcggct cgctcttata gcgcaacctt cgatgctgct      1140
     ggttctgcaa cattatgttt ttcatctctc gatgaactgt tccctgaaat catcgccagc      1200
     tcacgtgtga ccttcaactt cggggaagat gcgggatatg atggtgtaac gcttcacggt      1260
     tactctgatg ctctatccgg tactgaatat gcgcgtcgac actctgtcac cgccgacagc      1320
     tgtacaacgt gtcataccaa cggtagcaac taccacaaga acggtagcta caatgatggt      1380
     ggcttaggtt gtgtcgcgtg ccataacaat ggccaggacc gcaacgctaa gagctctgca      1440
     ccaggttttg gtcctatggt ccacagcatg cactggggag tcggtaacac ggcgacagat      1500
     cccgatggtg aagcaaactc ggcagctaag ttaaatgccg aaaactgtgt cgcctgccat      1560
     gctgaaggta tcgatatcga tgctatccct aatcaatata tcttatctaa agcctataac      1620
     ggcggagagt cgggtgtgat gaccagtccg gtaaccgcta actgctttgc ttgtcataat      1680
     gatgattcgg ctaagaatca catgcttcaa caaggtggcg aaatcaacgt tgagaagctt      1740
     gaagattggt acacattacc aacatcagaa tcttgttcaa cttgtcatgc cgaggggaaa      1800
     tcttacggta tcgagaagtt ccatgtattc gaacgttaa                             1839
//

If you have problems or comments...

PBIL Back to PBIL home page