(data stored in ACNUC7421 zone)

EMBL: CP000821.PE450

CP000821.PE450       Location/Qualifiers
FT   CDS_pept        complement(563331..564059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0450"
FT                   /product="protein of unknown function DUF28"
FT                   /note="KEGG: slo:Shew_3408 protein of unknown function
FT                   DUF28"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35063"
FT                   /db_xref="GOA:A8FQE0"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQE0"
FT                   /protein_id="ABV35063.1"
FT                   /translation="MGRAYQNKKESMAKTAGQKTRIYSRYGKELYVCAKNGGFDPDGNL
FT                   PLRQLIAKAKKDQVPAHVIERAIEKAKGGGGEDYETARYEGFGPGGCMVIVDCLTDNGK
FT                   RTFTEVRQAFVKNDAKLGGPGTVGHMFEHQAIFVFAGEDEEEVLEMLMMADVDVTDVEV
FT                   EDGMISVYAPNTEFYKTKTALNEAMPEVEFVVEEITFVPQTMTDISDPEVIEQLEKFLA
FT                   ALEDCDDVQNVYHNAEFAEN"
     atgggaagag cataccagaa caagaaagaa tccatggcaa aaacggctgg gcagaaaacc        60
     agaatatatt ctcgctatgg taaagagctc tacgtttgcg caaaaaatgg tggtttcgat       120
     cctgatggta accttccact acgccagttg atcgccaagg ccaagaaaga ccaggtaccg       180
     gctcatgtta tcgaacgtgc gatcgaaaag gccaaggggg gcggcggtga agattatgaa       240
     actgcacgtt acgaaggctt tggtcctggt ggctgcatgg tcatcgtcga ttgcttaacc       300
     gacaacggca agcgcacctt caccgaagtt cgtcaggcat tcgttaaaaa tgacgccaaa       360
     ctgggtggcc cgggtaccgt cggtcacatg ttcgaacacc aagccatttt tgttttcgcc       420
     ggagaagatg aagaggaagt acttgagatg ttgatgatgg ccgatgtcga cgtcacagat       480
     gttgaagtcg aagatggcat gatcagtgtc tatgcaccga ataccgagtt ttacaagact       540
     aagactgcat tgaacgaagc catgcctgaa gtcgaatttg tggttgaaga gatcaccttc       600
     gtgccacaaa ccatgacaga tatcagcgat cctgaagtga tcgagcagtt agagaaattc       660
     ctcgctgccc tcgaagattg tgatgacgtg caaaatgtct accacaacgc tgagtttgct       720
     gaaaactaa                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page