(data stored in ACNUC7421 zone)

EMBL: CP000821.PE452

CP000821.PE452       Location/Qualifiers
FT   CDS_pept        565201..566259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0452"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="KEGG: shm:Shewmr7_3509 secretion protein HlyD family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35065"
FT                   /db_xref="GOA:A8FQE2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQE2"
FT                   /protein_id="ABV35065.1"
FT                   /translation="MSKSKLFIAVPLIFAALAGGAYYWWTQVRFFESTDNAYVEADISH
FT                   ISVKVPGYVVMTDITDNQHVNAGQLLAQLEDNQYEAKLAQSQAELDSSQAELQTLSAKV
FT                   ELQHALIAQAQAGVAAAGSDRLRSEQQLRRSKKLKEKNYSSQDDVDQMQASFESSVAHL
FT                   DEANAALVAKQRELAVFNAQLLQADANVVKAKAGLELAKIQLADTQVRAPFSGVIGKRG
FT                   ALKGQYVQPGQALYSLVPDGAVWITANFKETQIQHMQPGQSVQVNLDAFPDKTFTGVID
FT                   SLSPASGAKFSLLPAENATGNFTKIVQRIPVRIRLELGEERERLVPGLSAIVKVDTTTL
FT                   SLDSALAANIGH"
     atgtccaaga gtaaattatt cattgcggtg ccactgatat ttgcagcctt agctggtggt        60
     gcttattact ggtggacgca agttcgtttc ttcgagtcga ccgataatgc ctatgttgaa       120
     gcggatatct ctcatatcag cgtcaaggtt ccgggctatg tggtgatgac agacatcacc       180
     gataaccagc atgtcaacgc aggccagttg ctggcacagt tagaagataa tcagtatgaa       240
     gctaagttag cccagagtca ggccgagctt gatagctcac aagcagagtt gcaaaccctt       300
     tcggctaaag tagagctgca acacgcactg atcgctcagg ctcaggcggg agtcgcagcg       360
     gctggttcgg atcggttgcg atcggagcaa cagttgcgcc gatctaagaa gctaaaagag       420
     aagaattaca gctcccagga tgacgtggat cagatgcaag cgagtttcga gtcttctgtc       480
     gcgcatcttg atgaagctaa tgcggccttg gttgcaaagc aacgagagct tgcagtattt       540
     aatgcgcaac tgttacaggc cgatgcgaat gtcgtgaagg ctaaggcggg tttagagctt       600
     gccaaaatcc agttagcaga tacacaagtc agggcgccat tttctggcgt gataggtaag       660
     cgtggggccc tgaaggggca atacgttcag ccaggacagg cgctctacag tttggtaccg       720
     gatggggctg tttggatcac ggccaacttc aaagagactc agatccaaca tatgcagccc       780
     ggccagtcgg ttcaggtcaa tctcgatgcg tttcccgaca aaacctttac aggtgttatc       840
     gatagccttt cgccggcatc cggtgccaaa tttagtctgt tacccgcgga aaatgcgacg       900
     gggaatttta ccaagattgt tcagcgtatt ccggtgagga tccgcctgga actcggtgag       960
     gagcgggaga gactcgttcc aggcttgagt gcgatcgtta aggtcgatac cacaacattg      1020
     tcattagata gcgcacttgc tgctaacatc ggtcattaa                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page