(data stored in ACNUC7421 zone)

EMBL: CP000821.PE455

CP000821.PE455       Location/Qualifiers
FT   CDS_pept        complement(568499..568744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3396 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35068"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQE5"
FT                   /protein_id="ABV35068.1"
FT                   /translation="MQIAQQLKDRRETDLHHDVHWDSMTAEQKIALYNLHRFGYRLLFV
FT                   RHMHSGPLAVISQQNHLATISSHGEVDYRTDVQLRD"
     atgcaaatag cacaacaact gaaagacaga agagagacag atctgcatca tgacgtccat        60
     tgggactcta tgactgcaga gcaaaaaatt gctctctata acctgcaccg atttggctat       120
     cggctgttgt ttgttcgcca tatgcattca ggacctttgg ctgtgatctc tcaacaaaat       180
     catctggcaa cgataagtag ccatggtgaa gtggattaca ggacagatgt ccaactaagg       240
     gattaa                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page