(data stored in ACNUC7421 zone)

EMBL: CP000821.PE456

CP000821.PE456       Location/Qualifiers
FT   CDS_pept        569096..570025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0456"
FT                   /product="radical SAM domain protein"
FT                   /note="KEGG: shm:Shewmr7_3501 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35069"
FT                   /db_xref="GOA:A8FQE6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQE6"
FT                   /protein_id="ABV35069.1"
FT                   /translation="MHDADYCLFFSRECQPLNYIEPLFRPPSEWKSLILQVTNGCSWNR
FT                   CTFCDMYTAPQKRFRAQKLDKIAADIIAVAETGRSVHRVFLADGDAMSLPFDRLEAICL
FT                   LIREHLPDVTRISSYCLPRNLKNKTSEELSRLKALGLSLLYIGCESGDDEVLRRIEKGE
FT                   SFDSSLAALKKIKAAGIKSSVMILNGLGGTELSTQHAINSAKLMNASQPEYLSTLVVTL
FT                   PLGTERMDASFDGHFQLPDQHGLFVEMHTLLKHLELDKTIFRSDHASNYLVLKGTLGKD
FT                   KEKLIAQVEQAMTKPQSSGLRQEWQRGL"
     atgcatgatg cagattattg cttgttcttt agtagggagt gtcagccttt gaactatatt        60
     gagcctttgt ttcgtcctcc atcggaatgg aagtcactta ttctgcaggt gactaacggt       120
     tgtagttgga atcgttgcac cttttgtgac atgtataccg cgccgcagaa acgcttcagg       180
     gcgcagaagc tggataagat tgctgcggat attattgcgg ttgcagaaac tggtcgctcg       240
     gttcatcggg tgtttctcgc cgatggcgat gcgatgagct tgcccttcga cagactagag       300
     gccatctgct tgttgatccg tgagcacctg cccgacgtca cccggatcag cagttactgt       360
     ctgccaagaa acctcaagaa taagacctct gaagagttgt cccgtttaaa ggcactcggc       420
     ttatccctgc tctatatcgg ttgcgagagt ggtgatgatg aggtgctgcg acggatcgaa       480
     aaaggtgaaa gttttgactc gtcactggcc gcactgaaaa agataaaggc ggcaggcatt       540
     aaatcttcgg tgatgatttt aaatggactc ggtggcaccg agttatcaac gcaacatgct       600
     atcaactcgg ctaagttaat gaatgcgtct cagcctgagt acctctctac tctggtggtt       660
     acgctacctc tggggacaga gcgtatggat gcgagtttcg atggacattt tcagctgccg       720
     gatcaacatg gtttattcgt cgaaatgcac actctattga agcatctcga gctggataaa       780
     acgatttttc gctcggacca cgcttcaaat tacctcgtgt tgaaagggac tttaggtaaa       840
     gacaaggaga agttaatagc tcaagtggaa caggccatga ccaagccgca gtcgagcggt       900
     ttaagacagg agtggcagcg ggggctttag                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page