(data stored in ACNUC7421 zone)

EMBL: CP000821.PE458

CP000821.PE458       Location/Qualifiers
FT   CDS_pept        571153..571617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_3632 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35071"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQE8"
FT                   /protein_id="ABV35071.1"
FT                   /translation="MRTLLFVICTLLTSFAQASSYAEGDLVSQIQLQDQFENEITVSEG
FT                   TQTLLFSRNMKGGDIIKEALEVLTAEQKQASDKLVYVADISGMPSLIAKFVAIPQMKDL
FT                   PFSMALDREGETTRLLPSEKDQATLIKLDHLKVMSVSTFDSSAALIKALR"
     atgcgaaccc tgttattcgt tatatgtact ctgttgacca gctttgctca ggcatcatct        60
     tacgctgaag gcgatctggt ttctcagata caacttcagg accagtttga aaatgagatc       120
     accgtctctg aaggaaccca gaccctgctt tttagtcgta acatgaaagg cggagatatc       180
     atcaaagagg cacttgaggt gctgacggca gagcaaaaac aagcatcaga taagctggtt       240
     tatgtcgctg acataagtgg catgccctcc ttgattgcta agtttgtcgc tattcctcaa       300
     atgaaagatc ttccgttttc catggcactg gacagagagg gagaaacgac gcgtttgttg       360
     ccttccgaaa aagatcaggc aaccttgatc aagttagatc atttaaaggt aatgagtgtg       420
     agtaccttcg attccagtgc agcactcatt aaggcattga gatag                       465
//

If you have problems or comments...

PBIL Back to PBIL home page