(data stored in ACNUC7421 zone)

EMBL: CP000821.PE462

CP000821.PE462       Location/Qualifiers
FT   CDS_pept        complement(573219..573971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35075"
FT                   /db_xref="GOA:A8FQF2"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQF2"
FT                   /protein_id="ABV35075.1"
FT                   /translation="MNKKWLLLALFAAPQAMADDMIHWWDASVTALYGDNYDLAPSDKQ
FT                   TTFTFETAGAWQYGDWFAFQDLIYFNGSNVSSDSTTYGEISTRLSAGKISGKEIGFGPV
FT                   TDLSLAMTFEEGEGPVKSFLYGLGMDIAIPYFSYFQLNTYRREAISSGNISDGWQITPA
FT                   FRMDFPVGNSNIVFDGFFDWVFSADNQGYEENFHFNPQLKYDLGAVIFGSHEKNKFLVG
FT                   VEYDYWKNKYGVKGVDQNTYSVIAKYHF"
     atgaacaaaa aatggctttt actcgcgctt ttcgccgcac cacaggcgat ggccgatgat        60
     atgatccact ggtgggatgc cagcgtgacc gcgttatacg gcgataatta cgatctagcg       120
     ccttccgata agcaaaccac tttcaccttc gaaactgccg gcgcatggca atatggtgac       180
     tggtttgcgt ttcaggatct gatctatttc aacggttcga acgtcagtag tgacagcacg       240
     acctacggcg aaatctcgac tcgattgagt gccggtaaaa tttccggtaa agagatcggc       300
     tttggcccgg tcaccgacct gtctctggcc atgaccttcg aagagggtga aggaccggtt       360
     aagagcttcc tatatggtct tggcatggac atagctatcc cttactttag ctattttcaa       420
     ctcaatacct atcgacgtga agccatcagc agtggcaata tcagcgacgg ttggcagata       480
     actcccgcct ttagaatgga ctttcccgtt ggcaactcga acatagtatt cgatggtttc       540
     tttgactggg tattctctgc cgataaccaa ggctatgaag agaactttca cttcaatcct       600
     cagctgaaat atgacctggg cgcggtcatc ttcggaagcc acgagaaaaa caaattcctt       660
     gtcggtgtcg agtatgatta ctggaagaac aagtacggtg tcaaaggtgt cgatcaaaac       720
     acctactcgg ttatagctaa atatcacttc taa                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page