(data stored in ACNUC7421 zone)

EMBL: CP000821.PE463

CP000821.PE463       Location/Qualifiers
FT   CDS_pept        574310..574783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0463"
FT                   /product="protein of unknown function DUF107"
FT                   /note="KEGG: shw:Sputw3181_3627 protein of unknown function
FT                   DUF107"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35076"
FT                   /db_xref="GOA:A8FQF3"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQF3"
FT                   /protein_id="ABV35076.1"
FT                   /translation="MELSNPIIIWGCIGLALMLAEIIIPGGIVILLGGACLVVASALAV
FT                   GLVEGIVQSLTLWFIVSIVFLLGFRQLTQKLVGGDSHVDNTDEELDIYNQTAVVKETIG
FT                   PAQHQGRIEFQGIEWSALGDGSEIAAGTRVRIICRDNIALVVEPCPDEVNMSN"
     atggagttat caaatcccat cattatctgg ggctgcattg gactggcatt gatgctggct        60
     gagatcatta ttcccggggg aatcgtcatc ttgctcggtg gtgcttgtct ggttgtcgca       120
     tcggcactgg ctgttgggtt agtcgaagga atagtgcaaa gcctcacact ctggtttatc       180
     gtttctattg tctttttatt aggtttcagg cagcttaccc aaaagctggt tggcggagat       240
     tctcacgttg ataataccga tgaggaactc gatatctata atcagactgc cgtcgttaaa       300
     gagactatcg gtccggcgca acatcagggg cgaatcgaat ttcagggtat cgaatggtcg       360
     gcacttggcg atggtagcga aatcgctgcg ggaactcgcg tacgtatcat ctgccgggat       420
     aatatcgcct tggttgtcga accctgccca gacgaagtaa acatgagtaa ttaa             474
//

If you have problems or comments...

PBIL Back to PBIL home page