(data stored in ACNUC7421 zone)

EMBL: CP000821.PE464

CP000821.PE464       Location/Qualifiers
FT   CDS_pept        574914..575861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0464"
FT                   /product="band 7 protein"
FT                   /note="KEGG: slo:Shew_3387 band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35077"
FT                   /db_xref="GOA:A8FQF4"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQF4"
FT                   /protein_id="ABV35077.1"
FT                   /translation="MFVFTIFVLFIFFILYKLLLIVPMREVNVIERLGKFRAVLKPGFH
FT                   FLIPFFDRVAYKHEIREQVLDVPPQSCISKDNTQLEVDGLVYLKVMDGKLASYGIENYR
FT                   LAAVNLAQTTMRSEIGKLSLSQTFSERDSLNESIVREIDKASDPWGIKVLRYEIKNITP
FT                   SRKVIHTLEKQMEAERSKRAEITLANAEKAAMINLSEGERQEAINISEGQKLKRINEAK
FT                   GTAQEISIIAKAKAEGMELVSTALALDGGHEAMNMQLKEQFIGQVGKILNEAEISVVPA
FT                   EMAKLEGFFEGMEQVTHAVSSSSTGSNSVKGGRS"
     atgtttgtat ttacaatttt tgtcctgttt atctttttta ttctctataa gctgttgtta        60
     attgtcccta tgcgtgaggt caatgtgatc gaacgtctgg gtaaatttcg ggccgtgctt       120
     aagcccggtt ttcattttct tattcccttc ttcgaccgcg tggcctataa gcatgagatc       180
     cgtgagcagg tgctggatgt gccgccacag agttgtatct cgaaagataa cactcagctt       240
     gaggtcgatg gtttagtcta tctcaaggtg atggatggca agctggcgag ctatggtatc       300
     gaaaattacc gtctcgcggc ggtgaacctg gctcaaacaa ccatgcgttc agaaataggt       360
     aaactgtccc taagtcagac cttctctgag agagacagtc tcaatgagtc gatcgtacgt       420
     gagatcgata aagcctcaga cccatgggga attaaagtac ttcgctatga gataaagaac       480
     attacaccgt ctcgtaaggt gatacacacc ttagaaaaac agatggaagc cgagcggagt       540
     aagcgcgcgg agatcacctt agcgaatgca gagaaagctg cgatgattaa cctctctgag       600
     ggggagcgac aagaggcgat caacatctcc gagggacaga aactcaaacg catcaacgag       660
     gctaaaggta cggcgcaaga gatcagtatt attgctaagg cgaaggcaga ggggatggag       720
     cttgtctcaa ccgcgctggc gttagacggc ggacacgaag cgatgaacat gcagcttaag       780
     gagcagttta tcggtcaggt aggcaaaata ctcaatgagg ccgaaatttc cgttgttccg       840
     gctgagatgg caaagttgga aggcttcttc gaaggtatgg agcaggtgac gcatgctgtg       900
     agtagcagtt ctacaggctc aaattcagtg aaaggaggtc gctcatga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page