(data stored in ACNUC7421 zone)

EMBL: CP000821.PE465

CP000821.PE465       Location/Qualifiers
FT   CDS_pept        575858..576793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0465"
FT                   /product="band 7 protein"
FT                   /note="KEGG: slo:Shew_3386 band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35078"
FT                   /db_xref="GOA:A8FQF5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQF5"
FT                   /protein_id="ABV35078.1"
FT                   /translation="MIAGINTDLIVLGIWGLIFALFIIKLFQSIRLVPTKSAYIVERLG
FT                   KYHSTLDAGFHALVPFVDKVSYIHDLKEETIDVPPQECFSSDEVNVEVDGVIYISVVDP
FT                   VKASYGVTDYRYAAIQLAQTTTRSVIGTLDLDRTFEERDVISAKVVEVLDQAGAMWGIR
FT                   VHRYEIKNITPPETVKNAMEMQVNAERERRALLAKSEGDKQSKINRSEGIKAEMINLSE
FT                   GEMQKRINEAEGKGEEILTIAKATAESIELMATVIAAPGGKNVVRMQLGAQYLKQLDGL
FT                   SNGASRVVLPGNMMDFDHWMDSIGLEESKS"
     atgattgcag gcataaatac agatctaata gtgttaggta tctgggggct tatctttgcc        60
     ttatttatta ttaagttgtt tcaatcgatt cgtttagtgc cgactaaatc ggcttatatc       120
     gtagagcgtc ttggtaaata tcattcgact ctggatgcag gttttcatgc cctggtccct       180
     tttgtagaca aggtatccta tattcacgat cttaaagagg agactatcga tgtcccccct       240
     caggagtgtt tctccagcga tgaagtgaat gttgaggtcg atggcgttat ctatatctcg       300
     gtcgtggatc cggttaaggc cagctacggt gtgacagatt accgttatgc agcgatacaa       360
     ctggctcaaa ccaccactcg ttcagtgata ggaactctgg atcttgaccg caccttcgaa       420
     gagcgtgacg tgatcagtgc caaagtggtt gaagtactcg atcaggctgg cgccatgtgg       480
     ggcatccgtg tacatcgcta cgagataaag aatattaccc caccggaaac ggtgaaaaat       540
     gccatggaga tgcaggtgaa tgcagaacgt gagcgccgtg cactgttggc gaagagtgag       600
     ggggataagc agagtaagat caaccgctcc gaaggtatca aagccgagat gattaacctc       660
     tcggagggtg agatgcaaaa gcgtatcaac gaagcggaag gtaaggggga ggagatctta       720
     accatcgcca aggccaccgc cgagtctatc gaactcatgg ctaccgttat cgccgccccc       780
     ggtggtaaga atgtggttcg catgcagctc ggcgctcagt atcttaagca actggacggt       840
     ttgagcaatg gtgccagtag ggtggtactg ccagggaaca tgatggactt cgatcactgg       900
     atggacagca tcggtctgga agagagtaag tcctga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page