(data stored in ACNUC7421 zone)

EMBL: CP000821.PE469

CP000821.PE469       Location/Qualifiers
FT   CDS_pept        581370..582482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_0475 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35082"
FT                   /db_xref="GOA:A8FQF9"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQF9"
FT                   /protein_id="ABV35082.1"
FT                   /translation="MRQVVKFRLIFLSVAILCYAAGFQFLPETLEISNGQEISIAFALL
FT                   YFAFLPLLYWLCIIKLGKQKLWKLLLIVSLSCLMARLSFPVEIASYFEFIIWLRFPIIA
FT                   ILLGIELFLIVSVIKALWQARNLSGDPRINILEQFGQEDDRKRSMALALAMEPASWFYA
FT                   IPRFSRKHPPSVTHINLLSASRWHWLLLACATVLLAGASYVVIQPWSEITAIIVSSFIL
FT                   YGLILITANYRVSRHFSVYRHGDQLIINNGVWGFSLVKFDQIHRVMVSPPPCENRTGVI
FT                   NFGQGESSNIILKFKHPQTYFGGLGWLPEEVKAIAMVVDKPEALADLIFDISDERELEV
FT                   RRAELTPSWKESISQEVFEGNADMPTELTS"
     atgaggcagg tcgtgaagtt cagattgata ttcttgagtg tggctatcct ttgttacgct        60
     gcaggctttc aatttttacc cgagacactc gagatctcta atggacaaga gatatcgata       120
     gcgttcgcac tcctctattt tgcgtttctt cctctgctct actggttatg cattattaaa       180
     ttgggtaagc agaagttatg gaagttactg ctgatagtca gccttagctg tctgatggct       240
     cgattgagct ttccggttga aatcgccagc tatttcgaat ttatcatctg gttaaggttc       300
     cctattatcg ccatcttgtt ggggatagag cttttcttga tagtgagtgt tatcaaagcc       360
     ctgtggcagg ctcgcaactt gtctggcgat ccgagaatca atattctgga gcaattcgga       420
     caagaggatg atcggaagcg ctcaatggct ttagccttag ccatggaacc agcgagttgg       480
     ttctatgcca tcccccgatt ctcgcgcaaa catcctccct cagttacaca tataaacttg       540
     ttatccgcct ctcgctggca ttggctattg cttgcctgcg caactgtgct actggccggt       600
     gcgagttatg ttgtcataca accctggagt gagataacgg cgattatagt ctcgagcttt       660
     atcctgtatg gattaatact cattaccgct aattacagag tttccagaca cttctcagtt       720
     tatcgacatg gcgatcagct gataatcaat aatggtgtgt ggggatttag tctggttaaa       780
     ttcgatcaaa tacatagggt tatggtgagt ccgccgccat gtgaaaatcg caccggagtc       840
     attaattttg gacaggggga gagcagtaat atcatactca agttcaagca tcctcagacc       900
     tattttggcg gtttaggctg gctgcccgaa gaggtgaaag ccattgccat ggtcgtcgat       960
     aagcccgaag cgttagctga tcttattttt gatatctccg atgagaggga gcttgaggtt      1020
     cgcagggcag agttaacccc atcgtggaaa gagagcattt cgcaggaggt attcgagggg      1080
     aatgccgata tgccgactga attaacttct tga                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page