(data stored in ACNUC7421 zone)

EMBL: CP000821.PE47

CP000821.PE47        Location/Qualifiers
FT   CDS_pept        complement(60833..61006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0047"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_3629 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34660"
FT                   /db_xref="GOA:A8FP87"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP87"
FT                   /protein_id="ABV34660.1"
FT                   /translation="MTFRHGVLASFMLTVFNLILMNLCFRRARRSGDTYLLYPVIAGAL
FT                   LSFILMSYFFFF"
     atgaccttca gacacggtgt attagcttca tttatgctga cggtgttcaa tctgatcctg        60
     atgaacctct gctttcgccg tgccagacgc tcaggcgaca cttacctgct ataccctgtc       120
     attgcagggg cgctactctc gtttatcttg atgagttact ttttcttttt ctaa             174
//

If you have problems or comments...

PBIL Back to PBIL home page