(data stored in ACNUC7421 zone)

EMBL: CP000821.PE472

CP000821.PE472       Location/Qualifiers
FT   CDS_pept        584339..585871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0472"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdn:Sden_3419 kap P-loop"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35085"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQG2"
FT                   /protein_id="ABV35085.1"
FT                   /translation="MDPVIDEAQLARMERAKTFASKYEDWQPEYNWGNCKTNRQEYGKF
FT                   LCSFLTNSKDGLVVNLNGSWGTGKTQLLRRLYVELAEQNHPVVYINAWESDFCNDALSV
FT                   VSSEFLNQLGFIFSSNADKSITEKFNELKDGFGTCMKLLSGGASLVGEPVTAATASAAG
FT                   SVVDTLPKAESNSVVSNNVELVDKISQAHANRVLAMQDIKKQITALSLLMNEIHDLEAP
FT                   IVVLVDELDRCRPIYAIEMLEVIKHFFEAKGCVFLVATDTEALQHSVNAVYGAKFNSAS
FT                   YLKRFFARKIALSEISSLRYLKSKEFDFEKYSELGIRLHPFTKNQNYNIKYMAAVAKLI
FT                   GFELRDIDQVIQKFFASLDFIAKTRMNHKSDVINTVVLFTGIAEHHNGMTCFYNRESNV
FT                   HIDSEIRCVGNVLDGISVNDLMQSQLNAVVKVMSREVHSGGGSSISRGDNSNIECLKIQ
FT                   SYNFIRHATKRYDDFVFHEEMRSLIQLSESTVDRYWLWDDYKMLIELSGHIE"
     atggatccag taatagatga agctcagtta gcacggatgg aacgcgcaaa gacgtttgcg        60
     agcaaatatg aagattggca accagagtac aactggggaa attgcaagac taacaggcaa       120
     gagtatggca aatttttgtg ctcatttctg acaaatagca aagacggttt agttgttaat       180
     cttaatggtt cttggggaac cggtaaaact caactactta gacgtttata tgtagaactt       240
     gctgagcaaa atcaccctgt ggtgtatatc aatgcatggg aaagtgactt ttgtaatgat       300
     gctttatctg ttgttagtag cgagttcttg aatcaactgg gtttcatttt ttctagtaat       360
     gctgataagt ccatcactga gaagtttaat gagctgaaag atggttttgg tacttgtatg       420
     aagctcctga gtggtggagc ctctcttgtt ggagagcctg taacagcggc aacagcgagt       480
     gcagcaggtt cagttgttga taccttacct aaagctgaga gtaattcagt agtaagtaat       540
     aatgttgaat tagtcgataa gatatcccaa gctcacgcta atcgtgtatt ggctatgcaa       600
     gatataaaaa agcagataac cgctttgtca cttttgatga atgaaattca tgatttagaa       660
     gcaccgatag ttgttttggt tgatgaactt gatagatgta ggccgatata cgcgattgag       720
     atgctagaag tgattaagca tttctttgaa gcaaaaggtt gtgtattttt ggtcgcgaca       780
     gatacagaag cattgcaaca ttctgtaaat gctgtgtatg gagctaagtt taattcagca       840
     tcttatttga agcgtttttt tgccaggaaa atcgcgcttt cagaaatatc gtctctaagg       900
     tatttgaaat caaaagaatt tgattttgaa aagtacagtg agttaggaat taggttgcac       960
     ccatttacaa aaaaccagaa ctataacatt aagtatatgg cagccgttgc taagttaatt      1020
     ggttttgagt tgagagatat tgatcaggtt atacaaaagt tttttgcaag tttggacttt      1080
     atcgcaaaaa ccagaatgaa ccataaatca gacgtcatta ataccgttgt attgtttact      1140
     ggtatagcag aacaccataa cggaatgacg tgtttttata atcgagaaag caatgtgcat      1200
     atagattctg aaatacggtg tgtaggaaat gttttagatg ggatttcagt gaatgacctg      1260
     atgcagagtc agctaaatgc cgtagttaaa gtgatgtcta gagaggtaca ttccggtgga      1320
     ggaagttcaa taagccgggg ggataatagt aatattgagt gtcttaagat tcaatcatat      1380
     aactttattc gacatgcgac taaaaggtat gacgattttg tttttcatga ggagatgagg      1440
     agtctcattc aattaagtga gtccacggtt gataggtact ggctttggga tgattacaaa      1500
     atgctcattg agttatcagg tcacatcgag tga                                   1533
//

If you have problems or comments...

PBIL Back to PBIL home page