(data stored in ACNUC7421 zone)

EMBL: CP000821.PE473

CP000821.PE473       Location/Qualifiers
FT   CDS_pept        complement(586226..586804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0473"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35086"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR033653"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQG3"
FT                   /protein_id="ABV35086.1"
FT                   /translation="MKLTALTQPLYDHLYRDILQFRSTFDLPSEDETTLDDKADTLHTS
FT                   LAIEELTELAEADTRMEQADAIVDSVYVLMGRLVHLGATGVNDRIEISYVIDLLLHVAK
FT                   NREIDFVTCWDEVHSSNMSKVCRNEQELTETIEFYAKQGVEIVGSKKGDFIIAKCAKDV
FT                   DMAGKVVRQGKVLKSVYYRPADLAKLVKA"
     atgaaactca ccgcactaac tcagccactt tacgatcacc tttaccgtga tatcctccag        60
     ttccgttcaa ccttcgacct accgagcgaa gatgaaacca cattggatga caaggctgac       120
     accctgcaca cttcgttggc tatcgaagag ctaaccgaac ttgccgaagc cgatacccgc       180
     atggaacaag ccgacgccat cgtcgactct gtttatgtcc ttatgggccg cttagttcat       240
     cttggtgcca ctggggtaaa cgatcgcatc gagattagct acgtgatcga cctgctgtta       300
     catgtcgcca agaaccgcga aattgatttt gtgacctgct gggatgaagt tcactcaagc       360
     aacatgagta aggtgtgtcg caacgagcag gaattaaccg aaactatcga attttacgcc       420
     aagcaaggcg tcgagatcgt cggcagcaag aaaggtgact tcatcatcgc caagtgcgcc       480
     aaagatgtag atatggcggg taaggtcgtt cgtcagggta aggttttgaa atcggtttac       540
     taccgaccgg cagatctggc aaagctagtg aaagcttag                              579
//

If you have problems or comments...

PBIL Back to PBIL home page