(data stored in ACNUC7421 zone)

EMBL: CP000821.PE474

CP000821.PE474       Location/Qualifiers
FT   CDS_pept        complement(586959..587186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35087"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQG4"
FT                   /protein_id="ABV35087.1"
FT                   /translation="MKNNHHILSPFLLALLLCDCSSTEVIDTGITFGKETVKASQRRQE
FT                   RTNPSFRDDKVNSDDVANGLLNTIIKSVNN"
     atgaaaaata atcaccatat cctctccccc ttcttgctag cactactcct ctgtgattgc        60
     tccagcacag aggtcatcga cacgggtatc acatttggta aggagacggt aaaagcaagt       120
     cagcgaagac aagagcgtac aaatccctct tttagagacg ataaagttaa ctcagacgat       180
     gttgcaaatg gcttattaaa tacgattatt aaatccgtta ataattag                    228
//

If you have problems or comments...

PBIL Back to PBIL home page