(data stored in ACNUC7421 zone)

EMBL: CP000821.PE476

CP000821.PE476       Location/Qualifiers
FT   CDS_pept        complement(589131..591197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0476"
FT                   /product="peptidase S9, prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="KEGG: shn:Shewana3_0482 peptidase S9, prolyl
FT                   oligopeptidase active site domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35089"
FT                   /db_xref="GOA:A8FQG6"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQG6"
FT                   /protein_id="ABV35089.1"
FT                   /translation="MKTHKILPSVLSTALAASLFITGCSQTPSPTNLSDRATIQDQSQQ
FT                   VQLLPVEAFFNEQGISGLKSSSDGKWLAFFKEYQGAKNIYLMATGTDLDEAFPITTSKD
FT                   PIYSFRWSHQGNEIFFLKDTGGNENTQIYKLSLDTSQIKPVPNITALTSNTDIRYDLLK
FT                   QPKDKPNTLVVMSNQDNPQQMDLFRLNIDSAKITNIFSNTYGFSSIETNQQGVPVLGTS
FT                   SNPDNTSDLYAKISGKWTSLIKTQFGEDIDILSFDEDNNLAYLRANIQGRDKLQLLRLN
FT                   MTTGKIVTLHQDPQDESDVYDVLFNDEGAPLAVSYYGGRLRTYPLDETFADNWQKINDH
FT                   FTQDVEITITDRNEKTGLWQLHIASDVDMGSDYRFDANTGLVSLLLEQEASISPELLSK
FT                   RQSITYQARDGVTIQAYLTLPKGQTQNLPTVILPHGGPWSRDYWTLSSGYFNPIAQLLA
FT                   NRGYAVLQPNFRASTGFGKRFLNAGNKNWGTGSMQDDLTDGAHYLIKEGIADKQRLGIM
FT                   GASYGGYAALAGATFTPDLYQAVISYVGPSSLITLLESFPPHFRPYLGQFYSAVGDPEI
FT                   DTDRVDMKARSPINFVDNIRAPLMLVQGANDPRVTQIESDNIARVMYNRKLPVEYILAK
FT                   DEGHGFRKRDNKLAYIVAMEQFFGKHLGGRVDNAVTPALTAHLDTLKVDVSRL"
     atgaagacac ataagatttt acctagcgta ctctcgacag cgctcgccgc tagcttattt        60
     ataacaggct gctcgcagac cccttcacca acaaacttgt cagatcgagc cactatccaa       120
     gatcaaagtc agcaagttca actgctacct gttgaagcct ttttcaacga gcaagggatc       180
     agtggactca agagctccag tgacggaaag tggttagcct ttttcaaaga gtatcaaggc       240
     gcgaaaaaca tctatctgat ggccaccggt actgatctcg atgaagcttt tcctattacc       300
     acctcaaagg atccgattta cagcttccgc tggtcacacc aaggcaatga gatcttcttc       360
     cttaaagata ccggtggtaa tgaaaatacc cagatctata aactctctct ggatacgagc       420
     cagattaaac ctgtcccgaa catcactgcg ctcaccagta atacagacat cagatatgac       480
     ctgctcaaac aaccaaaaga taagcccaac actttggttg tcatgtcgaa tcaagataat       540
     cctcagcaga tggatctctt tcgtctgaat atcgattccg caaaaataac caatattttt       600
     tctaacacct acggcttctc ttccatagag acaaaccaac aaggcgttcc ggtactcggc       660
     accagcagta acccagacaa tacttccgat ctctacgcca aaatttctgg gaaatggacg       720
     agtctgatca agacccaatt tggtgaagac atagatattc ttagcttcga tgaagataac       780
     aacttggcct atcttcgtgc caacatccaa ggacgagaca agctacaact gttacgcctc       840
     aatatgacca caggtaaaat cgtcactcta catcaagatc cgcaggatga atctgatgtt       900
     tatgatgtgc tctttaacga tgaaggtgca ccacttgccg tctcctatta tggcggtcgt       960
     ttacgcactt acccgctgga tgaaaccttt gctgacaact ggcaaaaaat taacgaccac      1020
     ttcactcaag atgtggagat aaccatcaca gatagaaacg agaaaaccgg tctgtggcag      1080
     ctacatatcg ccagcgatgt cgatatggga agcgactatc gctttgatgc caatactgga      1140
     ctcgtgagcc ttttgcttga gcaagaagca tcgattagcc ctgagctgct atcaaaacgt      1200
     caatccatca cctaccaggc tcgcgatggc gtgaccattc aggcctatct gaccctacct      1260
     aagggacaaa cacaaaacct gccgacagtc attcttcccc atggtggccc ctggtcccga      1320
     gactactgga ctttaagttc aggctatttc aacccgattg ctcagctatt ggcaaaccgc      1380
     ggctatgcgg tattacagcc caactttcgt gcctctacag gctttggtaa acgcttcctc      1440
     aatgcaggca ataaaaactg gggcaccggc agcatgcagg acgatctgac cgacggggcg      1500
     cattacctca tcaaagaggg gatagccgat aaacagcgct tagggatcat gggcgcatct      1560
     tatggtggct atgcagcgct tgccggcgcg accttcaccc cggatctgta tcaggcggtg      1620
     atctcctatg tcggtccctc tagccttatt acactactgg aatcattccc tcctcacttc      1680
     cgtccctatc tgggtcagtt ttacagtgcg gtaggcgatc ctgagatcga tacagacaga      1740
     gtagatatga aggctcgttc tcccattaat ttcgtcgata acattagggc gccgctgatg      1800
     ttagtccaag gggcgaatga tcccagagtg acccaaattg aatccgataa tatcgcgcgg      1860
     gtgatgtata accgcaaact accggttgaa tacattctgg caaaagatga aggtcatggc      1920
     ttccgtaaac gggataataa gttagcctat attgtggcta tggagcagtt tttcggtaaa      1980
     cacctgggcg gccgagtaga taatgcggtg actcccgctc tcaccgcaca cctcgatacg      2040
     ctaaaggttg atgtgagccg attataa                                          2067
//

If you have problems or comments...

PBIL Back to PBIL home page