(data stored in ACNUC7421 zone)

EMBL: CP000821.PE477

CP000821.PE477       Location/Qualifiers
FT   CDS_pept        591383..591898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0477"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_0483 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35090"
FT                   /db_xref="GOA:A8FQG7"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQG7"
FT                   /protein_id="ABV35090.1"
FT                   /translation="MNANMQKLMKISGFFRLLVLIATTIMMVYLGYSFFVNGDIRFGAS
FT                   HLFHELWQDERASRGILLGLQSPLFIILLVGVYWLQKLLSHYQQGQFFGHEAMRCYLWL
FT                   VWLKVFDFGIEIIQHLGTGYYHKQFFEHTSIQLTIDFGDVTTILLMLLIVYLLKAAREL
FT                   EAENREFI"
     atgaatgcca atatgcagaa actgatgaag atcagcggtt tttttaggtt gctggttttg        60
     attgcgacaa caatcatgat ggtttatctg ggatacagtt tcttcgtcaa tggcgatatc       120
     cgctttgggg ccagtcacct gtttcatgaa ctctggcagg atgagcgtgc gagtagaggc       180
     atactcttag gcctccagtc ccccctgttt atcatactat tggttggggt ttattggtta       240
     cagaagctgc ttagccatta tcaacagggg caatttttcg gccatgaggc gatgcgctgt       300
     tatctgtggt tggtatggct aaaggtattc gacttcggaa tagagataat ccagcatctg       360
     gggacgggtt actaccataa acaatttttt gaacatacca gcatacaatt gacgatagat       420
     tttggtgatg tgaccacaat tttattaatg cttttaattg tttacttgct caaagcggcg       480
     agagagctcg aagccgaaaa cagagagttt atctag                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page