(data stored in ACNUC7421 zone)

EMBL: CP000821.PE480

CP000821.PE480       Location/Qualifiers
FT   CDS_pept        complement(592835..593263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0480"
FT                   /product="cytochrome c biogenesis protein"
FT                   /note="KEGG: shw:Sputw3181_0575 cytochrome c biogenesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35093"
FT                   /db_xref="GOA:A8FQH0"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQH0"
FT                   /protein_id="ABV35093.1"
FT                   /translation="MMRILFLMLLFSLSMSAMAATTTTGENSYTQDQIRDIGFEISYEL
FT                   RCPMSINQNLFDSQAPIANELKAQIFLMLEQGESKEAIIEFLVQRYGEKIKYQPSFSVA
FT                   TAMLWFGPLFLLLIIIAVAAMLIREQHKHQRTNGNSYE"
     atgatgcgta tcctcttttt gatgctgtta ttcagcctga gtatgagcgc aatggccgct        60
     accactacga caggtgaaaa cagctatacc caagatcaga tccgggatat cggctttgaa       120
     atctcctatg agctgcgctg ccccatgtcg ataaatcaaa atctgtttga ttcacaagcc       180
     cccatagcga atgaattgaa ggctcaaatt ttccttatgt tagagcaagg cgagtctaaa       240
     gaggccatta tcgaatttct ggttcaacgc tatggcgaga agattaagta tcagcccagt       300
     ttttctgtgg caaccgccat gctctggttt ggtccactct ttctgttgct gataattatc       360
     gccgtcgccg cgatgcttat ccgtgagcaa cataaacacc aaagaactaa tggtaactcc       420
     tatgaataa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page