(data stored in ACNUC7421 zone)

EMBL: CP000821.PE481

CP000821.PE481       Location/Qualifiers
FT   CDS_pept        complement(593260..595230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0481"
FT                   /product="cytochrome c-type biogenesis protein CcmF"
FT                   /note="KEGG: shw:Sputw3181_0576 cytochrome c-type
FT                   biogenesis protein CcmF"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35094"
FT                   /db_xref="GOA:A8FQH1"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQH1"
FT                   /protein_id="ABV35094.1"
FT                   /translation="MIPELGLILLIISTVSSLLLAVIPLVALHTKNHYLFSYVKTLTGL
FT                   MTFTITASILCLLISFITDDFSVAYVANHSNTQLALLYKVAAVWGSHEGSMLFWVVAIA
FT                   IWGCIIVFSSKYRDRLFIGRLIAILASVIAGFNLFMLFTSNPFARLLPNFPIEGRDLNP
FT                   ILQDIGLIFHPPLLFLGYVGLTVTFAAAIAALLGGKLTRTHAGYLRPWALLAWVFLTGG
FT                   NAFGSWWAYNELGWGGWWFWDPVENASFIPWLVATALLHSVVLSHRRDSFKVTTLLLCL
FT                   LAFSLSLLGTFLVRSGIVQSVHAFASDPTRGMSILFLLGVFVCGALTLFALKANQIKSE
FT                   LNFTLVSRDSVILLGNIVLVVAAISVLLGTFYPLLFELLDIGTLSVGAPYFNSIFIPLT
FT                   FMAVLLMGAAPLISWKREKFSALRPLIVLFIIALAIAETLSMLTGSGFNIWLFLGATSA
FT                   TWLILCLGYLLFRLRHQGIEGLARKSAMLIAHLGVAISIIGATSVSNFEQQELLRMGPA
FT                   QGKVVAGYTFVYEDTVNVDEKSYTAIQANIRVTDADDNFIGYITPQRQTFKTNAMEVSK
FT                   AGIMRNIFRDLYVSSGLQLSDTEYLIRISYKPLACWIWLGGLLMMLGGTIAALTGLYRL
FT                   RVQKAAYSNSNPIATRIEGLA"
     atgatcccag aactcggact tatacttcta attatcagca cagtatcatc tctgttactt        60
     gccgttattc cactcgttgc cctacacact aaaaatcatt accttttcag ctatgtaaag       120
     acattaaccg gattaatgac atttaccatt acggcttcta ttctttgtct gcttatctcg       180
     tttattaccg atgatttctc cgttgcctat gtcgccaacc attccaacac acaactggcg       240
     ctactctata aagttgcagc cgtctggggt agccacgaag gctctatgct gttttgggtt       300
     gtcgccattg ccatttgggg ttgcatcatc gtcttctcat ccaaatatcg agaccgctta       360
     tttatcggca ggttgatcgc aatattagcc tcggtgatag ccggctttaa cctgtttatg       420
     ctgtttactt cgaatccctt tgccaggtta ctgccaaatt tcccgataga gggccgagac       480
     cttaacccca tactgcaaga catagggtta atctttcatc caccgctact gtttcttggc       540
     tatgtcggcc tcacggtgac ctttgccgcc gcaattgcgg ctctgctcgg cggtaagctg       600
     acccggacac acgcaggcta tcttagacct tgggcactgc tggcatgggt atttctaacg       660
     ggcggcaatg ccttcggttc atggtgggcg tataacgaac tgggctgggg aggatggtgg       720
     ttttgggatc cggttgaaaa tgcctctttc attccatggc tggtcgccac cgcgttacta       780
     cactcggtgg ttttgagtca caggcgtgac agctttaagg tgaccaccct actcttgtgt       840
     ctgttagcct tctcgttaag cctgttaggc actttcctcg tccgttcggg tatcgtgcag       900
     tcggtgcacg ccttcgcatc cgatcccacc agagggatgt cgattctgtt cctgctcggc       960
     gtatttgtat gtggcgcctt aacccttttc gccctaaagg ctaatcagat taaatctgag      1020
     ctgaatttca cactggtatc gagagatagc gtgatattac tgggtaatat tgtcttagtg      1080
     gtcgcggcta tatccgtact gctcggcacc ttttatccac tgctgtttga gctactcgat      1140
     attggcaccc tgtccgtggg agcgccctac tttaacagca tcttcattcc tctcactttc      1200
     atggcagtgt tattgatggg agccgcacct ttaatttcat ggaaaagaga gaagttctcg      1260
     gcgctgagac ccttaatcgt actctttatc attgccctcg ccatcgccga aaccctgagc      1320
     atgctgacag gctcaggttt taatatctgg ctctttcttg gtgcaacatc ggccacatgg      1380
     ttgatcctgt gcttaggcta tctactgttc cgtttacgtc accagggaat agaaggctta      1440
     gccagaaaat ctgcgatgct catcgctcac cttggggttg ccattagcat aataggtgca      1500
     acatcggttt caaatttcga gcagcaggag ttgctgagaa tgggaccggc gcaaggtaag      1560
     gtcgttgccg gctatacctt cgtgtatgaa gatacggtca acgtggatga gaagagctat      1620
     accgctattc aggcaaatat tcgcgtgacc gatgccgatg ataattttat cggctatatc      1680
     acccctcaac gccagacctt caagaccaat gccatggagg tctccaaggc cggcattatg      1740
     cgtaatatct tcagggatct ttatgtttcc agtggtctac agctcagtga taccgaatat      1800
     ctcatccgca ttagctacaa gccgcttgcc tgctggatct ggttaggcgg actcttgatg      1860
     atgctgggag gaaccatagc ggcacttact ggcttatatc gcctgcgggt acaaaaagcg      1920
     gcctattcga acagcaatcc cattgccaca agaatagagg ggctagcatg a               1971
//

If you have problems or comments...

PBIL Back to PBIL home page