(data stored in ACNUC7421 zone)

EMBL: CP000821.PE483

CP000821.PE483       Location/Qualifiers
FT   CDS_pept        597859..598314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0483"
FT                   /product="rhodanese domain protein"
FT                   /note="KEGG: shw:Sputw3181_0578 rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35096"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQH3"
FT                   /protein_id="ABV35096.1"
FT                   /translation="MVEANKRIIMNKVLGIIILTFFLAALSPNSFAGGGSDMAPAKHHE
FT                   FQLNHITMVEAETLVGKEGVYFFDVNTLELWAEGYIPGAIYFNVRDWKKILPENKDAVM
FT                   VFYCANRLCNASEIAARAVMKLGYTGVRQMPDGIYGWRLSNRQTERP"
     atggtcgaag caaataagag aatcattatg aataaagtac ttggaataat tattttaact        60
     ttctttttag ctgcactatc tccaaatagt tttgctgggg gaggttctga tatggctccg       120
     gctaaacatc atgaatttca acttaaccat atcaccatgg tggaagcaga aacgttagta       180
     ggaaaggaag gtgtttactt ttttgatgtc aatacattgg aactgtgggc agagggatat       240
     attccaggtg ctatctactt caatgttaga gattggaaaa aaatactacc agaaaataaa       300
     gatgctgtga tggtttttta ttgtgcgaat cgtctctgta atgcaagtga aatagcggca       360
     agagcagtca tgaaacttgg ctataccggt gtaagacaga tgccagatgg tatttacggg       420
     tggaggttgt caaatcgaca aacagaaaga ccataa                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page