(data stored in ACNUC7421 zone)

EMBL: CP000821.PE485

CP000821.PE485       Location/Qualifiers
FT   CDS_pept        599191..599898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0485"
FT                   /product="Cytochrome c biogenesis factor-like protein"
FT                   /note="KEGG: shn:Shewana3_0492 formate-dependent nitrite
FT                   reductase, NrfG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35098"
FT                   /db_xref="GOA:A8FQH5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQH5"
FT                   /protein_id="ABV35098.1"
FT                   /translation="MNILLISIVALCVLLLMTFFGHHTLYRIKHTSFFSDCNELDSNRT
FT                   KYSRSSFSFVLLLNVTVITSVVTVYSYLGRYNEIDLARADVNVDYLLAAEINRARKQAN
FT                   EQPNDKSVLMGLARASMDGGLYLEAIEALDELLFYMGDDAEIIGLKATALYYKNHRSMT
FT                   SEVKLLTQSALALYPHDFNTRVLLANDAYINHKYQEAISHWQILLKNTKQPFNRNAIEF
FT                   AINNAKKNLFAKK"
     atgaatatat tactaattag tattgttgcg ctttgtgtat tgttactaat gacttttttt        60
     ggtcatcata ctttatatag aattaaacat acgtcatttt ttagtgattg taatgagctc       120
     gactcaaatc gtactaaata tagtcgttca agcttttcat ttgtactgtt attaaacgtc       180
     acggttatta ccagtgttgt tactgtctac tcatatttag gccgttacaa tgaaattgat       240
     ttagcaagag cagatgtaaa tgtcgattat ttactcgctg cggaaataaa cagagcaaga       300
     aaacaggcca atgagcagcc gaacgataaa tctgtgctca tgggcttggc cagggcatca       360
     atggatggag gattatacct cgaagctatt gaggctttag atgagctgtt gttctatatg       420
     ggtgacgatg ccgaaattat cggtttaaaa gctacagcac tatattataa gaatcatcgt       480
     tctatgacta gtgaagttaa attgctgact caaagtgcgc tagctttata tccgcatgac       540
     ttcaacacta gagtgttgtt agctaatgac gcctatatca atcacaagta tcaagaagcc       600
     ataagtcact ggcaaatttt attaaagaat actaagcagc catttaaccg caatgcaatt       660
     gagtttgcga ttaataatgc aaagaaaaat ctatttgcta aaaaataa                    708
//

If you have problems or comments...

PBIL Back to PBIL home page