(data stored in ACNUC7421 zone)

EMBL: CP000821.PE486

CP000821.PE486       Location/Qualifiers
FT   CDS_pept        599949..600653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0486"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: she:Shewmr4_0492 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35099"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQH6"
FT                   /protein_id="ABV35099.1"
FT                   /translation="MSENLERRRFLKCLGASSLIIAPLGCSSVEEEGESDQPHYTMVFD
FT                   QNKCTGCGECKLACTTANNLPEGKSRLLLEQQSGGVVGEVCPHCGKTDCDCQRKYVRVS
FT                   CQQCKNAPCVTVCPTGAAHRDEKTGIVTMDASKCAGCKYCIGACPYDARFINKETDVAD
FT                   NCDFCLNSKLSKGELPACVQACRYDALIFGDLNDPNSYVSKLLRVKDAVRMKPGFGTEP
FT                   SLRYIPIVKLGV"
     gtgagtgaaa atttagagag gcggaggttc ctaaagtgtt taggagctag ctctttgatt        60
     attgcaccac tagggtgtag ctctgtcgaa gaggaggggg agagtgatca gccccactac       120
     actatggtgt tcgaccaaaa taagtgtact ggctgcggtg agtgtaagct tgcctgtacc       180
     actgcaaata atctacccga aggtaagtca cgactcctgc ttgagcagca gtcgggtggc       240
     gtagtgggtg aagtatgccc acattgtgga aaaaccgatt gtgactgtca gcgcaaatat       300
     gtgcgagttt cttgtcagca gtgtaaaaac gcaccttgtg tcactgtatg tccaacaggt       360
     gctgcgcatc gtgatgagaa aacaggcatc gtcactatgg acgccagtaa gtgtgcaggt       420
     tgtaaatact gtatcggagc ttgtccatac gatgctcgtt ttatcaataa agagactgat       480
     gttgctgata actgtgattt ttgtttgaac tcaaaactgt ctaaaggtga actccctgcc       540
     tgtgttcaag cttgtcggta cgatgcactg atttttggtg atctcaatga tccaaactcc       600
     tatgtaagta agttgctcag agtgaaagat gcagttcgaa tgaagccagg cttcggaact       660
     gaacctagtt tgcgctacat acccatagtt aagttaggag tgtaa                       705
//

If you have problems or comments...

PBIL Back to PBIL home page